1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC Chemokines
  5. MCP-2 Protein/CCL8
  6. MCP-2/CCL8 Protein, Human (HEK293, His)

MCP-2/CCL8 Protein, Human (HEK293, His) is a CC chemokine that interacts with CCR1, CCR2B, CCR3, and CCR5 to mediate host inflammatory immune responses, tumorigenesis, and antiviral infections. MCP-2/CCL8 Protein, Human (HEK293, His ) is a recombinant human MCP-2/CCL8 (Q24-P99) protein expressed by HEK293 with a his tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

MCP-2/CCL8 Protein, Human (HEK293, His) is a CC chemokine that interacts with CCR1, CCR2B, CCR3, and CCR5 to mediate host inflammatory immune responses, tumorigenesis, and antiviral infections. MCP-2/CCL8 Protein, Human (HEK293, His ) is a recombinant human MCP-2/CCL8 (Q24-P99) protein expressed by HEK293 with a his tag[1][2].

Background

CCL8, also known as monocyte chemotactic protein 2 ( MCP2), is a small cell factor belonging to the CC chemokine family. First identified in human osteosarcoma cells, it is a protein encoded by the CCL8 gene located on human chromosome 17. CCL8 is mainly expressed in small intestine and peripheral blood cells. CCL8 can bind to several different chemokine cell surface receptors, such as CCR1, CCR2B, CCR3 and CCR5. CCL8 can act as a chemoattractant, attracting chemokines such as monocytes, lymphocytes, basophils and eosinophils to mediate inflammatory host responses. On the one hand, CCL8 contributes to the spread of breast cancer and promotes the migration and invasion of esophageal squamous cell carcinoma. On the other hand, it has also been reported that CCL8 inhibits cervical cancer tumor growth and exhibits anti-tumor metastatic effects in melanoma. cCL8 significantly activates ERK1/2 phosphorylation in glioblastoma cells and significantly reduces the invasiveness of glioma cells by neutralizing antibody blockade of tama-secreted CCL8. At the same time, CCL8 can act as a potent HIV1 inhibitor with high affinity for the receptor CCR5, which is one of the major co-receptors for HIV1[1][2].

In Vitro

MCP2/CCL8 (100 ng/mL, 48 h) can induce Epithelial-Mesenchymal Transition (EMT) by activation NF-κB signal pathway in human ESCC cell line Eca109 and promote migration and invasion of ESCC cells[3].

Biological Activity

Measured by its ability to chemoattract THP‑1 human acute monocytic leukemia cells. The ED50 for this effect is 0.2938 μg/mL.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P80075 (Q24-P99)

Gene ID
Molecular Construction
N-term
CCL8 (Q24-P99)
Accession # P80075
6*His
C-term
Synonyms
rHuCCL8, His; C-C Motif Chemokine 8; HC14; Monocyte Chemoattractant Protein 2; Monocyte Chemotactic Protein 2; MCP-2; Small-Inducible Cytokine A8; CCL8; MCP2; SCYA10; SCYA8
AA Sequence

QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKPHHHHHH

Molecular Weight

Approximately 13 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 20 mM PB,150 mM NaCl, 1 mM EDTA, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

MCP-2/CCL8 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MCP-2/CCL8 Protein, Human (HEK293, His)
Cat. No.:
HY-P7770
Quantity:
MCE Japan Authorized Agent: