1. Recombinant Proteins
  2. Others
  3. MDM4/MDMX Protein, Human (His)

MDM4/MDMX proteins cooperate with MDM2 to regulate TP53 (p53) and inhibit the transcriptional activation domains of p53 and p73. This hinders their ability to induce cell cycle arrest and apoptosis. MDM4/MDMX Protein, Human (His) is the recombinant human-derived MDM4/MDMX protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MDM4/MDMX proteins cooperate with MDM2 to regulate TP53 (p53) and inhibit the transcriptional activation domains of p53 and p73. This hinders their ability to induce cell cycle arrest and apoptosis. MDM4/MDMX Protein, Human (His) is the recombinant human-derived MDM4/MDMX protein, expressed by E. coli , with N-His labeled tag.

Background

MDM4/MDMX Protein collaborates with MDM2 in regulating TP53 (p53). It functions by inhibiting the transcriptional activation domain of p53 and p73, thereby impeding their ability to induce cell cycle arrest and apoptosis. Moreover, MDM4 hinders the degradation of MDM2 and can reverse MDM2-mediated degradation of TP53 while concurrently suppressing TP53 transactivation and apoptotic functions. The protein forms a trimeric complex with MDM2 and USP2 and interacts with TP53, TP73, and USP2. Notably, when phosphorylated, MDM4 interacts with YWHAG, exerting a negative regulatory effect on its activity towards TP53. These interactions highlight the intricate role of MDM4 in modulating key components of the TP53 pathway, contributing to the finely tuned regulation of cellular responses to stress and DNA damage.

Biological Activity

Measured by its ability to promote proliferation of A549 human non small cell lung cancer cell. The ED50 for this effect is 33.7 ng/mL, corresponding to a specific activity is 2.967×104 units/mg.

  • Measured by its ability to promote proliferation of A549 human non small cell lung cancer cell. The ED50 for this effect is 33.7 ng/mL , corresponding to a specific activity is 2.967×104 units/mg.
Species

Human

Source

E. coli

Tag

N-His

Accession

O15151-1/NP_002384.2 (M1-D134)

Gene ID
Molecular Construction
N-term
His
MDM4 (M1-D134)
Accession # O15151/NP_002384.2
C-term
Synonyms
Protein Mdm4; Protein Mdmx; MDM4; MDMX
AA Sequence

MTSFSTSAQCSTSDSACRISPGQINQVRPKLPLLKILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQHMVYCGGDLLGELLGRQSFSVKDPSPLYDMLRKNLVTLATATTDAAQTLALAQDHSMDIPSQD

Molecular Weight

Approximately 19.4 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.8.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

MDM4/MDMX Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MDM4/MDMX Protein, Human (His)
Cat. No.:
HY-P74756
Quantity:
MCE Japan Authorized Agent: