1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. METTL1 Protein, Human (His)

METTL1 Protein, Human (His)

Cat. No.: HY-P75926
COA Handling Instructions

The METTL1 protein is a catalytic component of the METTL1-WDR4 methyltransferase complex, which promotes the formation of N(7)-methylguanine in tRNA, mRNA, and miRNA. METTL1 Protein, Human (His) is the recombinant human-derived METTL1 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $35 In-stock
10 μg $75 In-stock
50 μg $210 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The METTL1 protein is a catalytic component of the METTL1-WDR4 methyltransferase complex, which promotes the formation of N(7)-methylguanine in tRNA, mRNA, and miRNA. METTL1 Protein, Human (His) is the recombinant human-derived METTL1 protein, expressed by E. coli , with N-His labeled tag.

Background

METTL1, the catalytic component of the METTL1-WDR4 methyltransferase complex, is instrumental in mediating the formation of N(7)-methylguanine in various RNA species, including tRNAs, mRNAs, and microRNAs (miRNAs). Specifically, METTL1 catalyzes the addition of N(7)-methylguanine at position 46 (m7G46) within a significant subset of tRNAs containing the 5'-RAGGU-3' motif in the variable loop. This modification, such as m7G46, stabilizes tRNA tertiary structure and shields tRNAs from decay. METTL1 also serves as a methyltransferase for internal N(7)-methylguanine in mRNAs, particularly in response to stress, leading to the relocalization of methylated mRNAs to stress granules and consequent translational suppression. Furthermore, METTL1 methylates specific miRNAs, including let-7, facilitating let-7 miRNA processing by disrupting inhibitory secondary structures within primary miRNA transcripts. Beyond its role in RNA modification, METTL1 emerges as a regulator of embryonic stem cell self-renewal and differentiation.

Biological Activity

Measured in a cell proliferation assay using HepG2 cells. The ED50 for this effect is 0.9259 ng/mL, corresponding to a specific activity is 1.080×106 units/mg.

  • Measured in a cell proliferation assay using HepG2 cells. The ED50 for this effect is 0.9259 ng/mL , corresponding to a specific activity is 1.080×106 units/mg.
Species

Human

Source

E. coli

Tag

N-His

Accession

Q9UBP6-1/NP_005362.3 (D32-Q265)

Gene ID
Molecular Construction
N-term
His
METTL1 (D32-Q265)
Accession # Q9UBP6-1/NP_005362.3
C-term
Synonyms
tRNA (guanine-N(7)-)-methyltransferase; Methyltransferase-like protein 1; METTL1; C12orf1
AA Sequence

DHTLRYPVKPEEMDWSELYPEFFAPLTQNQSHDDPKDKKEKRAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAPAGGFQNIACLRSNAMKHLPNFFYKGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDVLELHDWMCTHFEEHPLFERVPLEDLSEDPVVGHLGTSTEEGKKVLRNGGKNFPAIFRRIQDPVLQ

Molecular Weight

Approximately 30 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of 50 mM Tris, 0.5 M NaCl, 20% Glycerol, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

METTL1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
METTL1 Protein, Human (His)
Cat. No.:
HY-P75926
Quantity:
MCE Japan Authorized Agent: