1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. MIA Protein, Human (His)

MIA proteins exhibit significant growth inhibitory effects on melanoma cells in vitro, extending their effects to various neuroectodermal tumors such as gliomas. In addition to playing an inhibitory role in cell growth, MIA proteins are also involved in molecular interactions, interacting with FASLG and TMIGD2. MIA Protein, Human (His) is the recombinant human-derived MIA protein, expressed by E. coli , with C-6*His labeled tag. The total length of MIA Protein, Human (His) is 107 a.a., with molecular weight of ~14.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock
10 μg Ask For Quote & Lead Time
50 μg Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MIA proteins exhibit significant growth inhibitory effects on melanoma cells in vitro, extending their effects to various neuroectodermal tumors such as gliomas. In addition to playing an inhibitory role in cell growth, MIA proteins are also involved in molecular interactions, interacting with FASLG and TMIGD2. MIA Protein, Human (His) is the recombinant human-derived MIA protein, expressed by E. coli , with C-6*His labeled tag. The total length of MIA Protein, Human (His) is 107 a.a., with molecular weight of ~14.0 kDa.

Background

Melanoma Inhibitory Activity (MIA) is a protein known for its growth-inhibitory effects on melanoma cells in vitro and displays similar actions on various neuroectodermal tumors, such as gliomas. MIA's ability to elicit growth inhibition suggests its potential role as a tumor suppressor, particularly in the context of malignancies originating from neuroectodermal tissues. Additionally, MIA interacts with FASLG, indicating its involvement in cellular processes related to apoptosis and immune response. Furthermore, its interaction with TMIGD2 suggests a potential role in modulating signaling pathways or cellular adhesion. The multifaceted interactions and growth-inhibitory properties of MIA highlight its significance in the regulation of tumor growth and its potential therapeutic relevance in neuroectodermal cancers.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

Q16674 (G25-Q131)

Gene ID
Molecular Construction
N-term
MIA (G25-Q131)
Accession # Q16674
6*His
C-term
Synonyms
Melanoma-Derived Growth Regulatory Protein; Melanoma Inhibitory Activity Protein; MIA
AA Sequence

GPMPKLADRKLCADQECSHPISMAVALQDYMAPDCRFLTIHRGQVVYVFSKLKGRGRLFWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTDKWDFYCQ

Molecular Weight

Approximately 14.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

MIA Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MIA Protein, Human (His)
Cat. No.:
HY-P70846
Quantity:
MCE Japan Authorized Agent: