MIF Protein, Mouse

MIF Protein, Mouse has assumed an important role as a pivotal regulator of innate immunity.MIF Protein, Mouse promotes the pro-inflammatory functions of immune cells.

Macrophage Migration Inhibitory Factor (MIF) has assumed an important role as a pivotal regulator of innate immunity. MIF is an integral component of the host antimicrobial alarm system and stress response that promotes the pro-inflammatory functions of immune cells. MIF-directed therapies might offer new treatment opportunities for human diseases in the future^[1].

1.Measured in a cell proliferation assay using MCF-7 human breast cancer cells. The ED₅₀ this effect is ≤10.51 ng/mL, corresponding to a specific activity is ≥9.515×10⁴ units/mg.
2.Measured by its ability to inhibit THP-1 cells migration. The ED₅₀ for this effect is ≤ 9.142 ng/mL, corresponding to a specific activity is ≥1.094×10⁵ U/mg.

• 
  Measured in a cell proliferation assay using MCF-7 human breast cancer cells. The ED₅₀ this effect is 3.326 ng/mL, corresponding to a specific activity is 3.006×10⁵ units/mg.

Mouse

E. coli

Tag Free

P34884 (M1-A115)

17319  [NCBI]

MPMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA

Approximately 11 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized as a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4 or PBS, 1 mM DTT, pH 7.4 or PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Calandra T, et al. Macrophage migration inhibitory factor: a regulator of innate immunity. Nat Rev Immunol. 2003 Oct;3(10):791-800.  [Content Brief]