1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC Chemokines
  5. MIP-3 alpha/CCL20
  6. MIP-3 alpha/CCL20 Protein, Rhesus macaque (GST)

MIP-3 alpha/CCL20 Protein, Rhesus macaque (GST)

Cat. No.: HY-P700549
Handling Instructions Technical Support

MIP-3 alpha/CCL20 Protein, part of the intercrine beta (chemokine CC) family, is instrumental in regulating immune cell migration and inflammation. Recognized for attracting and activating dendritic cells and memory T cells, it plays a vital role in immune response at infection or inflammation sites. Operating via its receptor CCR6, MIP-3 alpha/CCL20 initiates events that enhance immune cell recruitment and activation. As a potential therapeutic target, it holds promise for immune response modulation and inflammation control in diverse pathological conditions. MIP-3 alpha/CCL20 Protein, Rhesus macaque (GST) is the recombinant Rhesus Macaque-derived MIP-3 alpha/CCL20 protein, expressed by E. coli, with N-GST labeled tag. The total length of MIP-3 alpha/CCL20 Protein, Rhesus macaque (GST) is 70 a.a., with molecular weight of 35.1 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MIP-3 alpha/CCL20 Protein, part of the intercrine beta (chemokine CC) family, is instrumental in regulating immune cell migration and inflammation. Recognized for attracting and activating dendritic cells and memory T cells, it plays a vital role in immune response at infection or inflammation sites. Operating via its receptor CCR6, MIP-3 alpha/CCL20 initiates events that enhance immune cell recruitment and activation. As a potential therapeutic target, it holds promise for immune response modulation and inflammation control in diverse pathological conditions. MIP-3 alpha/CCL20 Protein, Rhesus macaque (GST) is the recombinant Rhesus Macaque-derived MIP-3 alpha/CCL20 protein, expressed by E. coli, with N-GST labeled tag. The total length of MIP-3 alpha/CCL20 Protein, Rhesus macaque (GST) is 70 a.a., with molecular weight of 35.1 kDa.

Background

The MIP-3 alpha/CCL20 protein belongs to the intercrine beta (chemokine CC) family, a group of chemokines involved in the regulation of immune cell migration and inflammation. This protein is known for its role in attracting and activating immune cells, particularly dendritic cells and memory T cells, to sites of infection or inflammation. MIP-3 alpha/CCL20 functions through binding to its receptor, CCR6, and initiates a cascade of cellular events that promote immune cell recruitment and activation. It plays a crucial role in the immune response against pathogens and is also involved in the development of certain inflammatory diseases. MIP-3 alpha/CCL20 is considered as a potential therapeutic target for modulating immune responses and controlling inflammation in various pathological conditions.

Species

Rhesus Macaque

Source

E. coli

Tag

N-GST

Accession

Q8HYP6 (A27-M96)

Gene ID
Molecular Construction
N-term
GST
CCL20 (A27-M96)
Accession # Q8HYP6
C-term
Synonyms
rHuMIP-3α/CCL20; C-C motif chemokine 20; MIP3A; SCYA20
AA Sequence

ASNFDCCLRYTDRILHPKFIVGFTQQLANETCDINAVVFHTKKGLSVCANPKQTWVKLIVRRLSKKINKM

Molecular Weight

35.1 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

MIP-3 alpha/CCL20 Protein, Rhesus macaque (GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MIP-3 alpha/CCL20 Protein, Rhesus macaque (GST)
Cat. No.:
HY-P700549
Quantity:
MCE Japan Authorized Agent: