MMP-16 Protein, Human (I152N, His)

The MMP-16 protein functions as an endopeptidase capable of degrading various components of the extracellular matrix, particularly type III collagen and fibronectin. Its effects extend to the activation of progelatinase A, which contributes to the dynamic remodeling of the extracellular matrix within blood vessels. MMP-16 Protein, Human (I152N, His) is the recombinant human-derived MMP-16 protein, expressed by E. coli , with C-10*His labeled tag. The total length of MMP-16 Protein, Human (I152N, His) is 260 a.a, with molecular weight of ~29  kDa.

MMP-16 (Matrix Metalloproteinase-16) is an endopeptidase pivotal in the degradation of diverse extracellular matrix components, including collagen type III and fibronectin. It demonstrates the ability to activate progelatinase A, contributing to the regulation of matrix remodeling in blood vessels. The short isoform of MMP-16 is particularly notable for its cleavage of fibronectin and collagen type III, albeit at a reduced rate, with no discernible effect on collagen types I, II, IV, and V. However, in the presence of CSPG4, MMP-16 may play a role in the degradation and invasion of type I collagen by melanoma cells. This dual functionality underscores the complex and context-dependent nature of MMP-16's involvement in extracellular matrix dynamics, highlighting its potential implications in physiological and pathological processes, including those associated with vascular remodeling and cancer progression.

Measured by its ability to cleave a fluorogenic peptide substrate Mca-KPLGL-Dpa-AR-NH2. The specific activity is >250 pmol/min/µg.

Human

E. coli

C-10*His

P51512 (A32-G291, I152N)

4325  [NCBI]

ATVCGTEQYFNVEVWLQKYGYLPPTDPRMSVLRSAETMQSALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFHIRRKRYALTGQKWQHKHITYSIKNVTPKVGDPETRKANRRAFDVWQNVTPLTFEEVPYSELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYG

Approximately 29 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, 200 mM arginine, 0.4% SKL, 20% Glycerol, pH 8.0.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.