MUCL1 Protein, Human (HEK293, His)

The MUCL1 protein has the potential to serve as a diagnostic marker for metastatic breast cancer, providing utility in identifying and characterizing this disease stage. It can serve as a molecular marker to aid diagnosis and evaluation and have an impact on treatment planning and prognosis. MUCL1 Protein, Human (HEK293, His) is the recombinant human-derived MUCL1 protein, expressed by HEK293 , with C-His labeled tag. The total length of MUCL1 Protein, Human (HEK293, His) is 70 a.a., with molecular weight of ~8.4 KDa.

The MUCL1 protein is suggested to potentially play a role as a diagnostic marker for metastatic breast cancer, indicating its potential utility in identifying and characterizing this particular stage of the disease. The implication is that MUCL1 could serve as a molecular indicator, aiding in the diagnosis and assessment of metastatic breast cancer, which may have implications for treatment planning and prognosis. The precise mechanisms and specificity of MUCL1 in the context of breast cancer diagnosis remain areas of interest, highlighting its potential significance as a biomarker in clinical settings.

Human

HEK293

C-His

Q96DR8 (N21-P90)

118430  [NCBI]

NPTTAAPADTYPATGPADDEAPDAETTAAATTATTAAPTTATTAASTTARKDIPVLPKWVGDLPNGRVCP

Approximately 20-30 kDa due to glycosylation

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.