Muellerian-inhibiting factor/AMH Protein, Mouse

Mullerian inhibitory factor (AMH) plays a crucial role in various reproductive processes. It contributes significantly to Mullerian duct degeneration in male fetal sex differentiation. Muellerian-inhibiting factor/AMH Protein, Mouse is the recombinant mouse-derived Muellerian-inhibiting factor/AMH protein, expressed by E. coli , with tag free. The total length of Muellerian-inhibiting factor/AMH Protein, Mouse is 103 a.a., with molecular weight of ~14 kDa.

The Müllerian-inhibiting factor (AMH) protein plays a pivotal role in various reproductive processes. During male fetal sexual differentiation, it contributes significantly to Muellerian duct regression. In the adult, AMH assumes a role in Leydig cell differentiation and function. Conversely, in females, AMH acts as a negative regulator, impeding the primordial to primary follicle transition and reducing the FSH sensitivity of growing follicles. AMH exerts its effects by binding to its sole type II receptor, AMHR2, which recruits type I receptors ACVR1 and BMPR1A, subsequently activating the Smad pathway. Structurally, AMH exists as a homodimer, with disulfide linkages contributing to its stability. The diverse functions of AMH underscore its crucial involvement in orchestrating key events in both male and female reproductive development and maintenance.

Mouse

E. coli

Tag Free

P27106 (D450-C552)

11705  [NCBI]

DKGQDGPCALRELSVDLRAERSVLIPETYQANNCQGACRWPQSDRNPRYGNHVVLLLKMQARGAALGRLPCCVPTAYAGKLLISLSEERISADHVPNMVATEC

Approximately 14 kDa.The reducing (R) protern migrat es as 14 kDa in SDS-PAGE may be due to molecular structure of protein.

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.