Myoglobin Protein, Mouse (P.pastoris, His)

Myoglobin Protein, a crucial member of the globin family, acts as a reserve oxygen supply, facilitating efficient oxygen transport within muscles.Myoglobin Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Myoglobin protein, expressed by P.pastoris , with C-Myc, N-6*His labeled tag.

Myoglobin protein serves as a vital reserve supply of oxygen and aids in the efficient transport of oxygen within muscles. It is a member of the globin family, which encompasses various proteins involved in oxygen binding and transport throughout the body.

Mouse

P. pastoris

N-6*His

P04247 (2G-154G)

17189  [NCBI]

GLSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKTHPETLDKFDKFKNLKSEEDMKGSEDLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEIIIEVLKKRHSGDFGADAQGAMSKALELFRNDIAAKYKELGFQG

Approximately 21 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against solution in 20 mM Tris-HC1, 0.5 M NaCl, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.