1. Recombinant Proteins
  2. Others
  3. NECAP2 Protein, Human (His)

NECAP2 Protein, Human (His)

Cat. No.: HY-P70922
Handling Instructions

NECAP2 protein plays a pivotal role in endocytosis, interacting with adapter protein complexes AP-1 and AP-2, specifically with AP1G1 and AP2A1. Additionally, it connects with GAE domain proteins GGA1, GGA2, and GGA3, participating in a network of interactions that orchestrate endocytic events. NECAP2 emerges as a key regulator in cellular processes associated with membrane trafficking and vesicular transport. NECAP2 Protein, Human (His) is the recombinant human-derived NECAP2 protein, expressed by E. coli , with N-6*His, C-6*His labeled tag. The total length of NECAP2 Protein, Human (His) is 263 a.a., with molecular weight of ~35.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

NECAP2 protein plays a pivotal role in endocytosis, interacting with adapter protein complexes AP-1 and AP-2, specifically with AP1G1 and AP2A1. Additionally, it connects with GAE domain proteins GGA1, GGA2, and GGA3, participating in a network of interactions that orchestrate endocytic events. NECAP2 emerges as a key regulator in cellular processes associated with membrane trafficking and vesicular transport. NECAP2 Protein, Human (His) is the recombinant human-derived NECAP2 protein, expressed by E. coli , with N-6*His, C-6*His labeled tag. The total length of NECAP2 Protein, Human (His) is 263 a.a., with molecular weight of ~35.0 kDa.

Background

NECAP2 protein assumes a pivotal role in the intricate process of endocytosis, where it interfaces with crucial components of adapter protein complexes AP-1 and AP-2, specifically interacting with AP1G1 and AP2A1. Furthermore, NECAP2 establishes connections with the GAE domain proteins GGA1, GGA2, and GGA3, revealing its involvement in a network of molecular interactions that contribute to the orchestration of endocytic events. Through these associations, NECAP2 emerges as a key player in regulating cellular processes associated with membrane trafficking and vesicular transport.

Species

Human

Source

E. coli

Tag

N-6*His;C-6*His

Accession

Q9NVZ3 (M1-F263)

Gene ID
Molecular Construction
N-term
6*His
NECAP2 (M1-F263)
Accession # Q9NVZ3
6*His
C-term
Synonyms
Adaptin ear-binding coat-associated protein 2; NECAP endocytosis associated protein 2; NECAP2
AA Sequence

MEESGYESVLCVKPDVHVYRIPPRATNRGYRAAEWQLDQPSWSGRLRITAKGQMAYIKLEDRTSGELFAQAPVDQFPGTAVESVTDSSRYFVIRIEDGNGRRAFIGIGFGDRGDAFDFNVALQDHFKWVKQQCEFAKQAQNPDQGPKLDLGFKEGQTIKLNIANMKKKEGAAGNPRVRPASTGGLSLLPPPPGGKTSTLIPPPGEQLAVGGSLVQPAVAPSSGGAPVPWPQPNPATADIWGDFTKSTGSTSSQTQPGTGWVQF

Molecular Weight

Approximately 35.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

NECAP2 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NECAP2 Protein, Human (His)
Cat. No.:
HY-P70922
Quantity:
MCE Japan Authorized Agent: