Neuregulin-4/NRG4 Protein, Human

Neuregulin-4 (NRG4) Protein, a low-affinity ligand for the ERBB4 tyrosine kinase receptor, serves as a signaling molecule that recruits ERBB1 and ERBB2 coreceptors. This recruitment leads to ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. NRG4 specifically interacts with the ERBB4 receptor, mediating cellular responses through its activation, without binding to ERBB1, ERBB2, and ERBB3 receptors. Neuregulin-4/NRG4 Protein, Human is the recombinant human-derived Neuregulin-4/NRG4 protein, expressed by E. coli , with tag free. The total length of Neuregulin-4/NRG4 Protein, Human is 61 a.a., with molecular weight of ~6.7 KDa.

Neuregulin-4 (NRG4), a low-affinity ligand for the ERBB4 tyrosine kinase receptor, acts as a signaling molecule that simultaneously recruits ERBB1 and ERBB2 coreceptors. This recruitment leads to ligand-stimulated tyrosine phosphorylation and subsequent activation of the ERBB receptors. Notably, NRG4 does not bind to the ERBB1, ERBB2, and ERBB3 receptors. It specifically interacts with the ERBB4 receptor, playing a role in mediating cellular responses through the activation of this particular receptor.

Measured in a cell proliferation assay using Raji human Burkitt's lymphoma cells. The ED₅₀ for this effect is 0.0144 μg/mL, corresponding to a specific activity is 6.944×10⁴ units/mg.

• 
  Measured in a cell proliferation assay using Raji human Burkitt's lymphoma cells. The ED₅₀ this effect is 0.0144 μg/mL, corresponding to a specific activity is 6.944×10^4 units/mg.

Human

E. coli

Tag Free

Q8WWG1 (GP&P2-F62)

145957  [NCBI]

GPPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNLF

Approximately 6.7-14 kDa.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris, 50 mM NaCl, pH 7.2 or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.