Neurturin Protein, Human

Neurturin protein, vital in neurobiology, is key to supporting sympathetic neuron survival and implicated in regulating the central nervous system (CNS). It influences neural growth, stability, and may modulate non-neuronal cell populations. Neurturin, a homodimer linked by disulfide bonds, maintains structural integrity for diverse cellular functions beyond neuronal survival. Neurturin Protein, Human is the recombinant human-derived Neurturin protein, expressed by E. coli , with tag free. The total length of Neurturin Protein, Human is 102 a.a., with molecular weight of ~15.0 kDa.

Neurturin protein, a vital factor in neurobiology, plays a key role in supporting the survival of sympathetic neurons in culture. Beyond its role in neuronal survival, Neurturin is suggested to have regulatory functions in the development and maintenance of the central nervous system (CNS), influencing the intricate processes governing neural growth and stability. Additionally, there is a potential involvement in modulating the size of non-neuronal cell populations, such as haemopoietic cells, underscoring its broader impact on cellular dynamics. Neurturin functions as a homodimer, held together by disulfide linkages, emphasizing its structural integrity in executing its diverse cellular functions.

Human

E. coli

Tag Free

Q99748 (A96-V197)

4902  [NCBI]

ARLGARPCGLRELEVRVSELGLGYASDETVLFRYCAGACEAAARVYDLGLRRLRQRRRLRRERVRAQPCCRPTAYEDEVSFLDAHSRYHTVHELSARECACV

Approximately 15.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20mM Citrate, 6% Sucrose, 4% Mannitol, 0.05% Tween 80, pH 4.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.