1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TGF-beta Superfamily Neurotrophic Factors
  4. GDNF family
  5. Neurturin
  6. Neurturin Protein, Human

Neurturin Protein, Human

Cat. No.: HY-P71155
Handling Instructions

Neurturin protein, vital in neurobiology, is key to supporting sympathetic neuron survival and implicated in regulating the central nervous system (CNS). It influences neural growth, stability, and may modulate non-neuronal cell populations. Neurturin, a homodimer linked by disulfide bonds, maintains structural integrity for diverse cellular functions beyond neuronal survival. Neurturin Protein, Human is the recombinant human-derived Neurturin protein, expressed by E. coli , with tag free. The total length of Neurturin Protein, Human is 102 a.a., with molecular weight of ~15.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Neurturin protein, vital in neurobiology, is key to supporting sympathetic neuron survival and implicated in regulating the central nervous system (CNS). It influences neural growth, stability, and may modulate non-neuronal cell populations. Neurturin, a homodimer linked by disulfide bonds, maintains structural integrity for diverse cellular functions beyond neuronal survival. Neurturin Protein, Human is the recombinant human-derived Neurturin protein, expressed by E. coli , with tag free. The total length of Neurturin Protein, Human is 102 a.a., with molecular weight of ~15.0 kDa.

Background

Neurturin protein, a vital factor in neurobiology, plays a key role in supporting the survival of sympathetic neurons in culture. Beyond its role in neuronal survival, Neurturin is suggested to have regulatory functions in the development and maintenance of the central nervous system (CNS), influencing the intricate processes governing neural growth and stability. Additionally, there is a potential involvement in modulating the size of non-neuronal cell populations, such as haemopoietic cells, underscoring its broader impact on cellular dynamics. Neurturin functions as a homodimer, held together by disulfide linkages, emphasizing its structural integrity in executing its diverse cellular functions.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q99748 (A96-V197)

Gene ID
Molecular Construction
N-term
Neurturin (A96-V197)
Accession # Q99748
C-term
Synonyms
Neurturin; NRTN
AA Sequence

ARLGARPCGLRELEVRVSELGLGYASDETVLFRYCAGACEAAARVYDLGLRRLRQRRRLRRERVRAQPCCRPTAYEDEVSFLDAHSRYHTVHELSARECACV

Molecular Weight

Approximately 15.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Neurturin Protein, Human
Cat. No.:
HY-P71155
Quantity:
MCE Japan Authorized Agent: