1. Recombinant Proteins
  2. Others
  3. NKG2DL2 Protein, Human (HEK293, His)

NKG2DL2 Protein activates KLRK1/NKG2D receptor, promoting natural killer cell cytotoxicity. Importantly, it does not bind beta2-microglobulin, confirmed by research findings. NKG2DL2 Protein, Human (HEK293, His) is the recombinant human-derived NKG2DL2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of NKG2DL2 Protein, Human (HEK293, His) is 192 a.a., with molecular weight of ~30.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

NKG2DL2 Protein activates KLRK1/NKG2D receptor, promoting natural killer cell cytotoxicity. Importantly, it does not bind beta2-microglobulin, confirmed by research findings. NKG2DL2 Protein, Human (HEK293, His) is the recombinant human-derived NKG2DL2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of NKG2DL2 Protein, Human (HEK293, His) is 192 a.a., with molecular weight of ~30.0 kDa.

Background

The NKG2DL2 protein functions by binding to and activating the KLRK1/NKG2D receptor, thereby facilitating natural killer cell cytotoxicity. Its interaction with KLRK1/NKG2D has been documented. Notably, this protein does not exhibit binding affinity to beta2-microglobulin, as indicated by research findings.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q9BZM5 (G26-S217)

Gene ID
Molecular Construction
N-term
NKG2DL2 (G26-S217)
Accession # Q9BZM5
6*His
C-term
Synonyms
NKG2D Ligand 2; N2DL-2; NKG2DL2; ALCAN-Alpha; Retinoic Acid Early Transcript 1H; UL16-Binding Protein 2; ULBP2; N2DL2; RAET1H
AA Sequence

GRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSS

Molecular Weight

Approximately 30.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

NKG2DL2 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NKG2DL2 Protein, Human (HEK293, His)
Cat. No.:
HY-P71164
Quantity:
MCE Japan Authorized Agent: