NLRP3 Protein, Mouse (His-SUMO)

The NLRP3 protein acts as a sensor in the NLRP3 inflammasome, which is activated in response to membrane defects caused by pathogens or damage signals. It assembles the inflammasome complex, including NLRP3, CASP1, and PYCARD/ASC. NLRP3 Protein, Mouse (His-SUMO) is the recombinant mouse-derived NLRP3 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

NLRP3 protein functions as the sensor component of the NLRP3 inflammasome, orchestrating inflammasome activation in response to defects in membrane integrity. Upon encountering pathogens or damage-associated signals affecting membrane integrity, NLRP3 initiates the assembly of the inflammasome polymeric complex composed of NLRP3, CASP1, and PYCARD/ASC. Recruitment of pro-caspase-1 to the NLRP3 inflammasome results in caspase-1 activation, subsequently cleaving and activating inflammatory cytokines IL1B and IL18, along with gasdermin-D (GSDMD), leading to cytokine secretion and pyroptosis. NLRP3 activation stimuli encompass a range of factors, including extracellular ATP, nigericin, reactive oxygen species, crystals, and various environmental particles. Notably, almost all stimuli induce intracellular K(+) efflux, contributing to membrane perturbation and NLRP3 activation. The activated NLRP3 is transported to the microtubule organizing center (MTOC) and, upon interaction with NEK7, undergoes relocalization to dispersed trans-Golgi network (dTGN) vesicle membranes, forming an active inflammasome complex. Additionally, NLRP3 plays a role in T helper 2 (Th2) cell differentiation, influencing Th2 cell-dependent processes such as asthma and tumor growth by regulating the transcription of key genes involved in these pathways.

Mouse

E. coli

N-SUMO;N-6*His

Q8R4B8-1 (M1-R153)

216799  [NCBI]

MTSVRCKLAQYLEDLEDVDLKKFKMHLEDYPPEKGCIPVPRGQMEKADHLDLATLMIDFNGEEKAWAMAVWIFAAINRRDLWEKAKKDQPEWNDTCTSHSSMVCQEDSLEEEWMGLLGYLSRISICKKKKDYCKMYRRHVRSRFYSIKDRNAR

Approximately 35 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against solution in 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0 or 50 mM Tris-HCL, 300 mM NaCL, 200 mM arginine, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.