1. Recombinant Proteins
  2. Others
  3. NLRP3 Protein, Mouse (His-SUMO)

The NLRP3 protein acts as a sensor in the NLRP3 inflammasome, which is activated in response to membrane defects caused by pathogens or damage signals. It assembles the inflammasome complex, including NLRP3, CASP1, and PYCARD/ASC. NLRP3 Protein, Mouse (His-SUMO) is the recombinant mouse-derived NLRP3 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE NLRP3 Protein, Mouse (His-SUMO)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The NLRP3 protein acts as a sensor in the NLRP3 inflammasome, which is activated in response to membrane defects caused by pathogens or damage signals. It assembles the inflammasome complex, including NLRP3, CASP1, and PYCARD/ASC. NLRP3 Protein, Mouse (His-SUMO) is the recombinant mouse-derived NLRP3 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Background

NLRP3 protein functions as the sensor component of the NLRP3 inflammasome, orchestrating inflammasome activation in response to defects in membrane integrity. Upon encountering pathogens or damage-associated signals affecting membrane integrity, NLRP3 initiates the assembly of the inflammasome polymeric complex composed of NLRP3, CASP1, and PYCARD/ASC. Recruitment of pro-caspase-1 to the NLRP3 inflammasome results in caspase-1 activation, subsequently cleaving and activating inflammatory cytokines IL1B and IL18, along with gasdermin-D (GSDMD), leading to cytokine secretion and pyroptosis. NLRP3 activation stimuli encompass a range of factors, including extracellular ATP, nigericin, reactive oxygen species, crystals, and various environmental particles. Notably, almost all stimuli induce intracellular K(+) efflux, contributing to membrane perturbation and NLRP3 activation. The activated NLRP3 is transported to the microtubule organizing center (MTOC) and, upon interaction with NEK7, undergoes relocalization to dispersed trans-Golgi network (dTGN) vesicle membranes, forming an active inflammasome complex. Additionally, NLRP3 plays a role in T helper 2 (Th2) cell differentiation, influencing Th2 cell-dependent processes such as asthma and tumor growth by regulating the transcription of key genes involved in these pathways.

Species

Mouse

Source

E. coli

Tag

N-SUMO;N-6*His

Accession

Q8R4B8-1 (M1-R153)

Gene ID
Molecular Construction
N-term
6*His-SUMO
NLRP3 (M1-R153)
Accession # Q8R4B8-1
C-term
Synonyms
Nlrp3; Cias1; Mmig1; Nalp3; Pypaf1; NACHT; LRR and PYD domains-containing protein 3; Cold autoinflammatory syndrome 1 protein homolog; Cryopyrin; Mast cell maturation-associated-inducible protein 1; PYRIN-containing APAF1-like protein 1
AA Sequence

MTSVRCKLAQYLEDLEDVDLKKFKMHLEDYPPEKGCIPVPRGQMEKADHLDLATLMIDFNGEEKAWAMAVWIFAAINRRDLWEKAKKDQPEWNDTCTSHSSMVCQEDSLEEEWMGLLGYLSRISICKKKKDYCKMYRRHVRSRFYSIKDRNAR

Molecular Weight

Approximately 35 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against solution in 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0 or 50 mM Tris-HCL, 300 mM NaCL, 200 mM arginine, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

NLRP3 Protein, Mouse (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NLRP3 Protein, Mouse (His-SUMO)
Cat. No.:
HY-P71598
Quantity:
MCE Japan Authorized Agent: