2. Recombinant Proteins
  3. Others
  4. Nmes1 Protein, Mouse (His-SUMO)

Nmes1 Protein, Mouse (His-SUMO)

Cat. No.: HY-P71587
Handling Instructions

Nmes1 protein is prominently expressed in diverse tissues such as vertebrae, brain, intestine, and stomach. Nmes1 Protein, Mouse (His-SUMO) is the recombinant mouse-derived Nmes1 protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Nmes1 protein is prominently expressed in diverse tissues such as vertebrae, brain, intestine, and stomach. Nmes1 Protein, Mouse (His-SUMO) is the recombinant mouse-derived Nmes1 protein, expressed by E. coli , with N-His, N-SUMO labeled tag.
Background

Nmes1 protein exhibits robust expression in various tissues, including vertebrae, brain, intestine, and stomach.
Species

Mouse
Source

E. coli
Tag

N-His;N-SUMO
Accession

Q810Q5 (M1-R83)
Gene ID
Molecular Construction
N-term
6*His-SUMO
Nmes1 (M1-R83)
Accession # Q810Q5
C-term
Synonyms
Nmes1Normal mucosa of esophagus-specific gene 1 protein
AA Sequence

MGVFQILMKNKELIPLAFFISVAATGATSFALYALKKTDVVIDRKRNPEPWEMVDPTQPQKLITINQQWKPVEELQKVRRATR

Molecular Weight

Approximately 25.6 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

Nmes1 Protein, Mouse (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Nmes1 Protein, Mouse (His-SUMO)
Cat. No.:
HY-P71587
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

SAFETY DATA SHEET (SDS)

English - EN (0 KB) Français - FR (0 KB) Deutsch - DE (0 KB) Norwegian - NO (0 KB) Español - ES (0 KB) Swedish - SV (0 KB)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.