1. Recombinant Proteins
  2. Others
  3. Notum Protein, Human (C330S, CHO, His)

Notum Protein serves as a crucial negative regulator of the Wnt signaling pathway, playing a specific role in mediating the depalmitoleoylation of WNT proteins. The process of serine palmitoleoylation of WNT proteins is essential for their efficient binding to frizzled receptors, and Notum's carboxylesterase activity is instrumental in modulating this aspect of the Wnt signaling cascade. Notum Protein, Human (C330S, CHO, His) is the recombinant human-derived Notum protein, expressed by CHO , with C-His labeled tag. The total length of Notum Protein, Human (C330S, CHO, His) is 371 a.a., with molecular weight of 36-45 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Notum Protein serves as a crucial negative regulator of the Wnt signaling pathway, playing a specific role in mediating the depalmitoleoylation of WNT proteins. The process of serine palmitoleoylation of WNT proteins is essential for their efficient binding to frizzled receptors, and Notum's carboxylesterase activity is instrumental in modulating this aspect of the Wnt signaling cascade. Notum Protein, Human (C330S, CHO, His) is the recombinant human-derived Notum protein, expressed by CHO , with C-His labeled tag. The total length of Notum Protein, Human (C330S, CHO, His) is 371 a.a., with molecular weight of 36-45 kDa.

Background

Notum is a carboxylesterase that functions as a critical negative regulator of the Wnt signaling pathway. This enzyme plays a specific role in mediating the depalmitoleoylation of WNT proteins. The serine palmitoleoylation of WNT proteins is essential for their efficient binding to frizzled receptors, which is a crucial step in Wnt signaling activation. By catalyzing the removal of palmitoleate moieties from WNT proteins, Notum attenuates Wnt signaling, contributing to the fine-tuned regulation of this pathway. It has to emphasize Notum's significance in modulating Wnt signaling by targeting the lipid modifications of WNT proteins, highlighting its role as a key regulatory factor in this essential cellular pathway.

Biological Activity

Measured by its esterase activity. The specific activity is 1118.156 pmol/min/µg, as measured under the described conditions.

Species

Human

Source

CHO

Tag

C-6*His

Accession

Q6P988 (S81-T451, C330S)

Gene ID
Molecular Construction
N-term
Notum (S81-T451, C330S)
Accession # Q6P988
His
C-term
Synonyms
Palmitoleoyl-protein carboxylesterase NOTUM; NOTUM; hNOTUM
AA Sequence

SAQQLNEDLRLHLLLNTSVTCNDGSPAGYYLKESRGSRRWLLFLEGGWYCFNRENCDSRYDTMRRLMSSRDWPRTRTGTGILSSQPEENPYWWNANMVFIPYCSSDVWSGASSKSEKNEYAFMGALIIQEVVRELLGRGLSGAKVLLLAGSSAGGTGVLLNVDRVAEQLEKLGYPAIQVRGLADSGWFLDNKQYRHTDCVDTITCAPTEAIRRGIRYWNGVVPERCRRQFQEGEEWNCFFGYKVYPTLRSPVFVVQWLFDEAQLTVDNVHLTGQPVQEGLRLYIQNLGRELRHTLKDVPASFAPACLSHEIIIRSHWTDVQVKGTSLPRALHCWDRSLHDSHKASKTPLKGCPVHLVDSCPWPHCNPSCPT

Molecular Weight

Approximately 36-45 kDa due to the glycosylation

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Notum Protein, Human (C330S, CHO, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Notum Protein, Human (C330S, CHO, His)
Cat. No.:
HY-P79357
Quantity:
MCE Japan Authorized Agent: