Notum Protein, Human (C330S, CHO, His)

Notum Protein serves as a crucial negative regulator of the Wnt signaling pathway, playing a specific role in mediating the depalmitoleoylation of WNT proteins. The process of serine palmitoleoylation of WNT proteins is essential for their efficient binding to frizzled receptors, and Notum's carboxylesterase activity is instrumental in modulating this aspect of the Wnt signaling cascade. Notum Protein, Human (C330S, CHO, His) is the recombinant human-derived Notum protein, expressed by CHO , with C-His labeled tag. The total length of Notum Protein, Human (C330S, CHO, His) is 371 a.a., with molecular weight of 36-45 kDa.

Notum is a carboxylesterase that functions as a critical negative regulator of the Wnt signaling pathway. This enzyme plays a specific role in mediating the depalmitoleoylation of WNT proteins. The serine palmitoleoylation of WNT proteins is essential for their efficient binding to frizzled receptors, which is a crucial step in Wnt signaling activation. By catalyzing the removal of palmitoleate moieties from WNT proteins, Notum attenuates Wnt signaling, contributing to the fine-tuned regulation of this pathway. It has to emphasize Notum's significance in modulating Wnt signaling by targeting the lipid modifications of WNT proteins, highlighting its role as a key regulatory factor in this essential cellular pathway.

Measured by its esterase activity. The specific activity is 1118.156 pmol/min/µg, as measured under the described conditions.

Human

CHO

C-6*His

Q6P988 (S81-T451, C330S)

147111  [NCBI]

SAQQLNEDLRLHLLLNTSVTCNDGSPAGYYLKESRGSRRWLLFLEGGWYCFNRENCDSRYDTMRRLMSSRDWPRTRTGTGILSSQPEENPYWWNANMVFIPYCSSDVWSGASSKSEKNEYAFMGALIIQEVVRELLGRGLSGAKVLLLAGSSAGGTGVLLNVDRVAEQLEKLGYPAIQVRGLADSGWFLDNKQYRHTDCVDTITCAPTEAIRRGIRYWNGVVPERCRRQFQEGEEWNCFFGYKVYPTLRSPVFVVQWLFDEAQLTVDNVHLTGQPVQEGLRLYIQNLGRELRHTLKDVPASFAPACLSHEIIIRSHWTDVQVKGTSLPRALHCWDRSLHDSHKASKTPLKGCPVHLVDSCPWPHCNPSCPT

Approximately 36-45 kDa due to the glycosylation

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.