1. Recombinant Proteins
  2. Others
  3. NPTX1 Protein, Human (HEK293, His)

The NPTX1 protein may mediate synaptic processes and may be involved in the uptake of synaptic substances during synaptic remodeling or the clustering of AMPA glutamate receptors at specific excitatory synapses. Its involvement suggests a role in dynamic regulation of synaptic structure and function. NPTX1 Protein, Human (HEK293, His) is the recombinant human-derived NPTX1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of NPTX1 Protein, Human (HEK293, His) is 410 a.a., with molecular weight of 50-55 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The NPTX1 protein may mediate synaptic processes and may be involved in the uptake of synaptic substances during synaptic remodeling or the clustering of AMPA glutamate receptors at specific excitatory synapses. Its involvement suggests a role in dynamic regulation of synaptic structure and function. NPTX1 Protein, Human (HEK293, His) is the recombinant human-derived NPTX1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of NPTX1 Protein, Human (HEK293, His) is 410 a.a., with molecular weight of 50-55 kDa.

Background

NPTX1 Protein emerges as a potential mediator in synaptic processes, suggesting involvement in either the uptake of synaptic material during synapse remodeling or the synaptic clustering of AMPA glutamate receptors at specific excitatory synapses. Its implication in these processes points to a role in the dynamic regulation of synaptic structure and function. Elucidating the specific mechanisms through which NPTX1 participates in synapse remodeling and AMPA receptor clustering could provide valuable insights into its role in synaptic plasticity and neurotransmission. Further exploration of NPTX1's functions may deepen our understanding of its specific implications in various neuronal processes and its potential significance in maintaining synaptic integrity and functionality.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q15818 (Q23-N432)

Gene ID
Molecular Construction
N-term
NPTX1 (Q23-N432)
Accession # Q15818
6*His
C-term
Synonyms
Neuronal pentraxin-1; NPTX1; NP1
AA Sequence

QDFGPTRFICTSVPVDADMCAASVAAGGAEELRSSVLQLRETVLQQKETILSQKETIRELTAKLGRCESQSTLDPGAGEARAGGGRKQPGSGKNTMGDLSRTPAAETLSQLGQTLQSLKTRLENLEQYSRLNSSSQTNSLKDLLQSKIDELERQVLSRVNTLEEGKGGPRNDTEERVKIETALTSLHQRISELEKGQKDNRPGDKFQLTFPLRTNYMYAKVKKSLPEMYAFTVCMWLKSSATPGVGTPFSYAVPGQANELVLIEWGNNPMEILINDKVAKLPFVINDGKWHHICVTWTTRDGVWEAYQDGTQGGSGENLAPYHPIKPQGVLVLGQEQDTLGGGFDATQAFVGELAHFNIWDRKLTPGEVYNLATCSTKALSGNVIAWAESHIEIYGGATKWTFEACRQIN

Molecular Weight

50-55 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS,1 mM EDTA, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

NPTX1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NPTX1 Protein, Human (HEK293, His)
Cat. No.:
HY-P71169
Quantity:
MCE Japan Authorized Agent: