NPTX1 Protein, Human (HEK293, His)

The NPTX1 protein may mediate synaptic processes and may be involved in the uptake of synaptic substances during synaptic remodeling or the clustering of AMPA glutamate receptors at specific excitatory synapses. Its involvement suggests a role in dynamic regulation of synaptic structure and function. NPTX1 Protein, Human (HEK293, His) is the recombinant human-derived NPTX1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of NPTX1 Protein, Human (HEK293, His) is 410 a.a., with molecular weight of 50-55 kDa.

NPTX1 Protein emerges as a potential mediator in synaptic processes, suggesting involvement in either the uptake of synaptic material during synapse remodeling or the synaptic clustering of AMPA glutamate receptors at specific excitatory synapses. Its implication in these processes points to a role in the dynamic regulation of synaptic structure and function. Elucidating the specific mechanisms through which NPTX1 participates in synapse remodeling and AMPA receptor clustering could provide valuable insights into its role in synaptic plasticity and neurotransmission. Further exploration of NPTX1's functions may deepen our understanding of its specific implications in various neuronal processes and its potential significance in maintaining synaptic integrity and functionality.

Human

HEK293

C-6*His

Q15818 (Q23-N432)

4884  [NCBI]

QDFGPTRFICTSVPVDADMCAASVAAGGAEELRSSVLQLRETVLQQKETILSQKETIRELTAKLGRCESQSTLDPGAGEARAGGGRKQPGSGKNTMGDLSRTPAAETLSQLGQTLQSLKTRLENLEQYSRLNSSSQTNSLKDLLQSKIDELERQVLSRVNTLEEGKGGPRNDTEERVKIETALTSLHQRISELEKGQKDNRPGDKFQLTFPLRTNYMYAKVKKSLPEMYAFTVCMWLKSSATPGVGTPFSYAVPGQANELVLIEWGNNPMEILINDKVAKLPFVINDGKWHHICVTWTTRDGVWEAYQDGTQGGSGENLAPYHPIKPQGVLVLGQEQDTLGGGFDATQAFVGELAHFNIWDRKLTPGEVYNLATCSTKALSGNVIAWAESHIEIYGGATKWTFEACRQIN

50-55 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS,1 mM EDTA, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.