NRG1-beta 1 Protein, Human (65a.a, His)

HRG1-β1 belongs to a family of structurally-related polypeptide growth factors derived from alternatively spliced genes, induces Fn14 expression in MCF7 cells. NRG1-beta 1 Protein, Human (65a.a, His) is the recombinant human-derived NRG1-beta 1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of NRG1-beta 1 Protein, Human (65a.a, His) is 65 a.a., with molecular weight of ~ 7.5 kDa.

HRG1-β1 activates HER2/HER3 signaling and up-regulate Fn14 gene expression in parental MCF7 cells. HRG1-β1-mediated Fn14 up-regulation in MCF7/HER2-18 cells is required for maximal MMP-9 production.

The ED₅₀ as determined in a serum-free cell proliferation assay using MCF7 human breast cancer cells is less than 3 ng/mL.

• 
  Measured in a cell proliferation assay using MCF-7 cells.The ED₅₀ for this effect is 5.691 ng/mL, corresponding to a specific activity is 1.757×10⁵ units/mg.

Human

E. coli

N-6*His

Q02297-6 (S177-E241)

3084  [NCBI]

SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAE

Approximately 7.5 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from sterile 50 mM Tris-HCL, 300 mM NaCL, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.