1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. EGF Superfamily
  4. Neuregulins
  5. Neuregulin-1 (NRG1)
  6. NRG1-beta 1 Protein, Human (65a.a, His)

NRG1-beta 1 Protein, Human (65a.a, His)

Cat. No.: HY-P72007
COA Handling Instructions

NRG1-α protein binds directly to ERBB3 and ERBB4 receptors, leading to the recruitment of ERBB1 and ERBB2 coreceptors. NRG1-beta 1 Protein, Human (65a.a, His) is the recombinant human-derived NRG1-beta 1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of NRG1-beta 1 Protein, Human (65a.a, His) is 65 a.a., with molecular weight of ~ 7.5 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $35 In-stock
10 μg $63 In-stock
50 μg $176 In-stock
100 μg $300 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

NRG1-α protein binds directly to ERBB3 and ERBB4 receptors, leading to the recruitment of ERBB1 and ERBB2 coreceptors. NRG1-beta 1 Protein, Human (65a.a, His) is the recombinant human-derived NRG1-beta 1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of NRG1-beta 1 Protein, Human (65a.a, His) is 65 a.a., with molecular weight of ~ 7.5 kDa.

Background

NRG1-alpha protein acts as a direct ligand for ERBB3 and ERBB4 tyrosine kinase receptors, concurrently recruiting ERBB1 and ERBB2 coreceptors, thereby inducing ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. The diverse functions of its multiple isoforms encompass the induction of growth and differentiation in various cell types, including epithelial, glial, neuronal, and skeletal muscle cells. NRG1-alpha is also involved in the expression of acetylcholine receptors during neuromuscular junction formation, the stimulation of lobuloalveolar budding and milk production in the mammary gland, and the induction of differentiation in mammary tumor cells. Furthermore, it stimulates Schwann cell proliferation and plays a role in myocardial development, specifically contributing to the trabeculation of the developing heart. Isoform 10 is implicated in motor and sensory neuron development. NRG1-alpha binds to ERBB4 and ERBB3, acting as a ligand for integrins and forming a ternary complex with integrins and ERBB3, a crucial step in NRG1-ERBB signaling. It induces the phosphorylation and activation of MAPK3/ERK1, MAPK1/ERK2, and AKT1. Additionally, NRG1-alpha participates in ligand-dependent ERBB4 endocytosis, essential for the activation of these kinases in neurons, and interacts with the LIM domain region of LIMK1. It also forms a ternary complex with ERBB3 and integrins ITGAV:ITGB3 or ITGA6:ITGB4 and interacts with NRDC and BACE1.

Biological Activity

The ED50 as determined in a serum-free cell proliferation assay using MCF7 human breast cancer cells is less than 3 ng/mL.

  • Measured in a cell proliferation assay using MCF-7 cells.The ED50 for this effect is 5.691 ng/mL, corresponding to a specific activity is 1.757×105 units/mg.
Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q02297-6 (S177-E241)

Gene ID
Molecular Construction
N-term
6*His
NRG1-beta 1 (S177-E241)
Accession # Q02297-6
C-term
Synonyms
Acetylcholine receptor-inducing activity; Acetylcholine receptor-inducing activity, chick, homolog of; ARIA; Breast cancer cell differentiation factor p45; GGF; GGF2; glial growth factor 2; Glial growth factor; Heregulin; heregulin, alpha 45kD, ERBB2 p185-activator; ; heregulin, alpha; HGL; HRG; HRG1; HRGA; MST131; MSTP131;
AA Sequence

SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAE

Molecular Weight

Approximately 7.5 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from sterile 50 mM Tris-HCL, 300 mM NaCL, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

NRG1-beta 1 Protein, Human (65a.a, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NRG1-beta 1 Protein, Human (65a.a, His)
Cat. No.:
HY-P72007
Quantity:
MCE Japan Authorized Agent: