1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. Nucleoside phosphorylase/PNP Protein, Human (His)

Nucleoside phosphorylase/PNP Protein, Human (His)

Cat. No.: HY-P74665
Handling Instructions Technical Support

Nucleoside phosphorylase/PNP proteins play a vital role in cellular processes by catalyzing the phosphate breakdown of β-(deoxy)ribonucleosides, preferably 6-oxopurine nucleosides, such as inosine and guanosine. This enzymatic activity results in the formation of free purine bases and pentose 1-phosphate, highlighting the importance of this protein in regulating nucleoside degradation. Nucleoside phosphorylase/PNP Protein, Human (His) is the recombinant human-derived Nucleoside phosphorylase/PNP protein, expressed by E. coli , with C-10*His labeled tag. The total length of Nucleoside phosphorylase/PNP Protein, Human (His) is 289 a.a., with molecular weight of ~33.5 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Nucleoside phosphorylase/PNP proteins play a vital role in cellular processes by catalyzing the phosphate breakdown of β-(deoxy)ribonucleosides, preferably 6-oxopurine nucleosides, such as inosine and guanosine. This enzymatic activity results in the formation of free purine bases and pentose 1-phosphate, highlighting the importance of this protein in regulating nucleoside degradation. Nucleoside phosphorylase/PNP Protein, Human (His) is the recombinant human-derived Nucleoside phosphorylase/PNP protein, expressed by E. coli , with C-10*His labeled tag. The total length of Nucleoside phosphorylase/PNP Protein, Human (His) is 289 a.a., with molecular weight of ~33.5 kDa.

Background

The Nucleoside phosphorylase/PNP protein assumes a crucial role in cellular processes by catalyzing the phosphorolytic breakdown of N-glycosidic bonds in beta-(deoxy)ribonucleoside molecules. This enzymatic activity results in the formation of the corresponding free purine bases and pentose-1-phosphate, as documented in relevant literature. Notably, the protein exhibits a preference for 6-oxopurine nucleosides, such as inosine and guanosine. The substrate specificity of Nucleoside phosphorylase/PNP underscores its significance in the regulated degradation of nucleosides, providing insights into its role in maintaining cellular purine homeostasis and contributing to the overall dynamics of nucleotide metabolism.

Biological Activity

Measured by the phosphorolysis of 7-methyl-6-thioguanosine. The specific activity is 4672.43 pmol/min/µg, as measured under the described conditions.

Species

Human

Source

E. coli

Tag

C-10*His

Accession

P00491 (M1-S289)

Gene ID
Molecular Construction
N-term
PNP (M1-S289)
Accession # P00491
10*His
C-term
Synonyms
Purine nucleoside phosphorylase; PNP; Inosine phosphorylase; NP
AA Sequence

MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS

Molecular Weight

Approximately 33.5 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized a 0.2 μm filtered solution of PBS, 25% glycerol, pH 7.5 or 50 mM Tris-HCL, 300 mM NaCl, 200 mM arginine, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Nucleoside phosphorylase/PNP Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Nucleoside phosphorylase/PNP Protein, Human (His)
Cat. No.:
HY-P74665
Quantity:
MCE Japan Authorized Agent: