NUDC Protein, Human (HEK293, His)

NUDC protein is essential for neurogenesis and neuronal migration, contributing to the correct formation of mitotic spindles and chromosome separation during mitosis. It plays a crucial role in cytokinesis and cell proliferation. NUDC interacts with PAFAH1B1, forms a complex with PLK1, dynein, and dynactin, and interacts with DCDC1 and EML4, emphasizing its multifaceted involvement in various cellular processes. NUDC Protein, Human (HEK293, His) is the recombinant human-derived NUDC protein, expressed by HEK293 , with C-His labeled tag. The total length of NUDC Protein, Human (HEK293, His) is 331 a.a., with molecular weight of ~39.7 kDa.

NUDC protein plays a crucial role in neurogenesis and neuronal migration. It is essential for the proper formation of mitotic spindles, accurate chromosome separation during mitosis, cytokinesis, and cell proliferation. NUDC interacts with key proteins such as PAFAH1B1, PLK1, DCDC1, and forms a complex with dynein and dynactin. Additionally, its interaction with EML4, specifically through the WD repeats, further emphasizes its involvement in cellular processes crucial for neurodevelopment and cell division.

Human

HEK293

C-His

Q9Y266 (M1-N331)

10726  [NCBI]

MGGEQEEERFDGMLLAMAQQHEGGVQELVNTFFSFLRRKTDFFIGGEEGMAEKLITQTFSHHNQLAQKTRREKRARQEAERREKAERAARLAKEAKSETSGPQIKELTDEEAERLQLEIDQKKDAENHEAQLKNGSLDSPGKQDTEEDEEEDEKDKGKLKPNLGNGADLPNYRWTQTLSELDLAVPFCVNFRLKGKDMVVDIQRRHLRVGLKGQPAIIDGELYNEVKVEESSWLIEDGKVVTVHLEKINKMEWWSRLVSSDPEINTKKINPENSKLSDLDSETRSMVEKMMYDQRQKSMGLPTSDEQKKQEILKKFMDQHPEMDFSKAKFN

Approximately 43-50 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCL, 500 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.