NUDT2 Protein, Human (His)

The NUDT2 protein has a dual enzymatic role as a catalyst for the asymmetric hydrolysis of diadenosine 5',5'''-P1,P4-tetraphosphate (Ap4A) to generate AMP and ATP. This activity highlights its involvement in nucleotide metabolism and the regulation of cellular purine nucleotide pools. NUDT2 Protein, Human (His) is the recombinant human-derived NUDT2 protein, expressed by E. coli , with N-His labeled tag. The total length of NUDT2 Protein, Human (His) is 147 a.a., with molecular weight of ~18.3 kDa.

NUDT2, or nudix hydrolase 2, is an enzyme that plays a pivotal role in nucleotide metabolism. It catalyzes the asymmetric hydrolysis of diadenosine 5',5'''-P1,P4-tetraphosphate (Ap4A), leading to the production of AMP and ATP. This enzymatic activity contributes to the regulation of cellular nucleotide pools. Additionally, NUDT2 exhibits decapping activity in vitro, targeting FAD-capped RNAs and dpCoA-capped RNAs. This dual functionality suggests its involvement in RNA turnover processes. It has to underscore NUDT2's significance in nucleotide metabolism, highlighting its capacity to hydrolyze Ap4A and its potential role in RNA decapping activities, contributing to the broader understanding of its functions in cellular processes related to nucleotide homeostasis and RNA metabolism.

Measured by its ability to the proliferation of MCF-7 human breast cancer cells. The ED₅₀ for this effect is 3.005 μg/mL, corresponding to a specific activity is 332.7787 Unit/mg.

• 
  Measured by its ability to the proliferation of MCF-7 human breast cancer cells. The ED₅₀ for this effect is 3.005 μg/mL, corresponding to a specific activity is 332.7787 Unit/mg.

Human

E. coli

N-His

P50583 (M1-A147)

318  [NCBI]

MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEA

Approximately 18.3-19 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.