1. Recombinant Proteins
  2. Enzymes & Regulators
  3. NUDT2 Protein, Human (His)

The NUDT2 protein has a dual enzymatic role as a catalyst for the asymmetric hydrolysis of diadenosine 5',5'''-P1,P4-tetraphosphate (Ap4A) to generate AMP and ATP. This activity highlights its involvement in nucleotide metabolism and the regulation of cellular purine nucleotide pools. NUDT2 Protein, Human (His) is the recombinant human-derived NUDT2 protein, expressed by E. coli , with N-His labeled tag. The total length of NUDT2 Protein, Human (His) is 147 a.a., with molecular weight of ~18.3 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The NUDT2 protein has a dual enzymatic role as a catalyst for the asymmetric hydrolysis of diadenosine 5',5'''-P1,P4-tetraphosphate (Ap4A) to generate AMP and ATP. This activity highlights its involvement in nucleotide metabolism and the regulation of cellular purine nucleotide pools. NUDT2 Protein, Human (His) is the recombinant human-derived NUDT2 protein, expressed by E. coli , with N-His labeled tag. The total length of NUDT2 Protein, Human (His) is 147 a.a., with molecular weight of ~18.3 kDa.

Background

NUDT2, or nudix hydrolase 2, is an enzyme that plays a pivotal role in nucleotide metabolism. It catalyzes the asymmetric hydrolysis of diadenosine 5',5'''-P1,P4-tetraphosphate (Ap4A), leading to the production of AMP and ATP. This enzymatic activity contributes to the regulation of cellular nucleotide pools. Additionally, NUDT2 exhibits decapping activity in vitro, targeting FAD-capped RNAs and dpCoA-capped RNAs. This dual functionality suggests its involvement in RNA turnover processes. It has to underscore NUDT2's significance in nucleotide metabolism, highlighting its capacity to hydrolyze Ap4A and its potential role in RNA decapping activities, contributing to the broader understanding of its functions in cellular processes related to nucleotide homeostasis and RNA metabolism.

Biological Activity

Measured by its ability to the proliferation of MCF-7 human breast cancer cells. The ED50 for this effect is 3.005 μg/mL, corresponding to a specific activity is 332.7787 Unit/mg.

  • Measured by its ability to the proliferation of MCF-7 human breast cancer cells. The ED50 for this effect is 3.005 μg/mL, corresponding to a specific activity is 332.7787 Unit/mg.
Species

Human

Source

E. coli

Tag

N-His

Accession

P50583 (M1-A147)

Gene ID

318  [NCBI]

Molecular Construction
N-term
His
NUDT2 (M1-A147)
Accession # P50583
C-term
Synonyms
Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical]; Ap4Aase; Nudix motif 2; APAH1
AA Sequence

MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEA

Molecular Weight

Approximately 18.3-19 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

NUDT2 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NUDT2 Protein, Human (His)
Cat. No.:
HY-P77108
Quantity:
MCE Japan Authorized Agent: