NUDT5 Protein, Human (His)

The NUDT5 protein acts as an ADP-glycopyrophosphatase or synthesizes ATP. NUDT5 Protein, Human (His) is the recombinant human-derived NUDT5 protein, expressed by E. coli , with N-His labeled tag. The total length of NUDT5 Protein, Human (His) is 218 a.a., with molecular weight of 30-35 KDa.

NUDT5, a versatile enzyme, exhibits dual functionality by acting as an ADP-sugar pyrophosphatase in the absence of diphosphate and catalyzing ATP synthesis in the presence of diphosphate. In the absence of diphosphate, NUDT5 demonstrates hydrolytic activity towards various modified nucleoside diphosphates, including ADP-ribose, ADP-mannose, ADP-glucose, 8-oxo-GDP, and 8-oxo-dGDP. Additionally, it can hydrolyze other nucleotide sugars with low activity. When dephosphorylated at Thr-45, NUDT5 facilitates ATP synthesis in the nucleus by converting ADP-ribose to ATP and ribose 5-phosphate. This nuclear ATP generation is crucial for energy-consuming chromatin remodeling events. Despite its diverse enzymatic activities, NUDT5 does not play a role in U8 snoRNA decapping activity, although it exhibits binding affinity for U8 snoRNA.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

N-His

Q9UKK9 (E2-F219)

11164  [NCBI]

ESQEPTESSQNGKQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQRTLHYECIVLVKQFRPPMGGYCIEFPAGLIDDGETPEAAALRELEEETGYKGDIAECSPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLKF

30-35 kDa.

Greater than 95% as determined by Tris-Bis PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 50 mM Tris-HCL, 300 mM NaCl, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.