Osteocrin Protein, Human (His)

Osteocrin protein regulates dendritic growth in the developing cerebral cortex by inhibiting branching. It is induced in the brain upon membrane depolarization and binds to the natriuretic peptide receptor NPR3/NPR-C, preventing the interaction with natriuretic peptides and increasing cproduction. Osteocrin also interacts with NPR3, further modulating dendritic growth regulation. Osteocrin Protein, Human (His) is the recombinant human-derived Osteocrin protein, expressed by E. coli , with N-6*His labeled tag. The total length of Osteocrin Protein, Human (His) is 106 a.a., with molecular weight of ~12.0 kDa.

Osteocrin protein serves as a crucial regulator of dendritic growth in the developing cerebral cortex, responding to sensory experience. It is induced in the brain upon membrane depolarization and works to inhibit dendritic branching in neurons of the developing cortex. This protein likely achieves its effects by binding to the natriuretic peptide receptor NPR3/NPR-C, thereby preventing the interaction between NPR3/NPR-C and natriuretic peptides, ultimately resulting in increased cproduction. Additionally, Osteocrin interacts with NPR3, further modulating its activity in dendritic growth regulation.

Human

E. coli

N-6*His

P61366 (V28-G133)

344901  [NCBI]

VDVTTTEAFDSGVIDVQSTPTVREEKSATDLTAKLLLLDELVSLENDVIETKKKRSFSGFGSPLDRLSAGSVDHKGKQRKVVDHPKRRFGIPMDRIGRNRLSNSRG

Approximately 12.0-13.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris, 150 mM NaCl, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.