1. Recombinant Proteins
  2. Others
  3. Osteocrin Protein, Human (His)

Osteocrin protein regulates dendritic growth in the developing cerebral cortex by inhibiting branching. It is induced in the brain upon membrane depolarization and binds to the natriuretic peptide receptor NPR3/NPR-C, preventing the interaction with natriuretic peptides and increasing cproduction. Osteocrin also interacts with NPR3, further modulating dendritic growth regulation. Osteocrin Protein, Human (His) is the recombinant human-derived Osteocrin protein, expressed by E. coli , with N-6*His labeled tag. The total length of Osteocrin Protein, Human (His) is 106 a.a., with molecular weight of ~12.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Osteocrin protein regulates dendritic growth in the developing cerebral cortex by inhibiting branching. It is induced in the brain upon membrane depolarization and binds to the natriuretic peptide receptor NPR3/NPR-C, preventing the interaction with natriuretic peptides and increasing cproduction. Osteocrin also interacts with NPR3, further modulating dendritic growth regulation. Osteocrin Protein, Human (His) is the recombinant human-derived Osteocrin protein, expressed by E. coli , with N-6*His labeled tag. The total length of Osteocrin Protein, Human (His) is 106 a.a., with molecular weight of ~12.0 kDa.

Background

Osteocrin protein serves as a crucial regulator of dendritic growth in the developing cerebral cortex, responding to sensory experience. It is induced in the brain upon membrane depolarization and works to inhibit dendritic branching in neurons of the developing cortex. This protein likely achieves its effects by binding to the natriuretic peptide receptor NPR3/NPR-C, thereby preventing the interaction between NPR3/NPR-C and natriuretic peptides, ultimately resulting in increased cproduction. Additionally, Osteocrin interacts with NPR3, further modulating its activity in dendritic growth regulation.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P61366 (V28-G133)

Gene ID
Molecular Construction
N-term
6*His
Osteocrin (V28-G133)
Accession # P61366
C-term
Synonyms
Osteocrin; Musclin; OSTN
AA Sequence

VDVTTTEAFDSGVIDVQSTPTVREEKSATDLTAKLLLLDELVSLENDVIETKKKRSFSGFGSPLDRLSAGSVDHKGKQRKVVDHPKRRFGIPMDRIGRNRLSNSRG

Molecular Weight

Approximately 12.0-13.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris, 150 mM NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Osteocrin Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Osteocrin Protein, Human (His)
Cat. No.:
HY-P71181
Quantity:
MCE Japan Authorized Agent: