PAP Protein, Human (His)

PAP proteins play a dual regulatory role in cell growth, exhibiting different effects depending on the specific growth factors involved. In fibroblasts, it exerts a positive regulatory effect by enhancing PDGFA-stimulated cell growth. PAP Protein, Human (His) is the recombinant human-derived PAP protein, expressed by E. coli , with N-6*His labeled tag. The total length of PAP Protein, Human (His) is 181 a.a., with molecular weight of ~30.0 kDa.

PAP protein plays a dual regulatory role in cell growth, demonstrating contrasting effects depending on the specific growth factor involved. In fibroblasts, it acts as a positive regulator by enhancing PDGFA-stimulated cell growth. However, simultaneously, it acts as a negative regulator by inhibiting the mitogenic effect of PDGFB. This protein exerts a fine-tuned control over cell growth, potentially influencing cellular responses to different growth factors and contributing to the overall balance and regulation of cell proliferation. The intricate interplay between PAP protein and growth factors like PDGFA and PDGFB highlights the complexity of cellular growth regulation and the importance of understanding the specific molecular mechanisms involved.

Human

E. coli

N-6*His

Q13442 (M1-K181)

11333  [NCBI]

MPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGDGAAGDPKKEKKSLDSDESEDEEDDYQQKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRREREEIEKQKAKERYMKMHLAGKTEQAKADLARLAIIRKQREEAARKKEEERKAKDDATLSGKRMQSLSLNK

Approximately 30.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 100 mM NaCl, 0.1 mM PMSF, 2 mM DTT, pH 8.0.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.