1. Recombinant Proteins
  2. Others
  3. PAX8 Protein, Human (His)

PAX8 protein, a crucial transcription factor, is essential for thyroid-specific gene expression, maintaining the functional differentiation of thyroid cells. It plays a pivotal role in regulating the thyroid-specific gene profile, contributing to specialized thyroid cell function. PAX8 also interacts with WWTR1, indicating a potential partnership in modulating gene expression and cellular processes in thyroid cells. PAX8 Protein, Human (His) is the recombinant human-derived PAX8 protein, expressed by E. coli , with C-His labeled tag. The total length of PAX8 Protein, Human (His) is 145 a.a..

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PAX8 protein, a crucial transcription factor, is essential for thyroid-specific gene expression, maintaining the functional differentiation of thyroid cells. It plays a pivotal role in regulating the thyroid-specific gene profile, contributing to specialized thyroid cell function. PAX8 also interacts with WWTR1, indicating a potential partnership in modulating gene expression and cellular processes in thyroid cells. PAX8 Protein, Human (His) is the recombinant human-derived PAX8 protein, expressed by E. coli , with C-His labeled tag. The total length of PAX8 Protein, Human (His) is 145 a.a..

Background

The PAX8 protein operates as a transcription factor essential for the thyroid-specific expression of genes exclusive to thyroid cells, thereby preserving the functional differentiation of these cells. PAX8 plays a pivotal role in regulating the thyroid-specific gene expression profile, contributing to the specialized function of thyroid cells. Additionally, PAX8 interacts with WWTR1, suggesting a potential partnership in modulating gene expression and cellular processes within the thyroid cell type.

Species

Human

Source

E. coli

Tag

C-His

Accession

Q06710 (P2-S146)

Gene ID
Molecular Construction
N-term
PAX8 (P2-S146)
Accession # Q06710
His
C-term
Synonyms
Paired box protein Pax-8; PAX8
AA Sequence

PHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDS

Molecular Weight

Approximately 17 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4, 10% glycerol or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PAX8 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PAX8 Protein, Human (His)
Cat. No.:
HY-P74651
Quantity:
MCE Japan Authorized Agent: