PAX8 Protein, Human (His)

PAX8 protein, a crucial transcription factor, is essential for thyroid-specific gene expression, maintaining the functional differentiation of thyroid cells. It plays a pivotal role in regulating the thyroid-specific gene profile, contributing to specialized thyroid cell function. PAX8 also interacts with WWTR1, indicating a potential partnership in modulating gene expression and cellular processes in thyroid cells. PAX8 Protein, Human (His) is the recombinant human-derived PAX8 protein, expressed by E. coli , with C-His labeled tag. The total length of PAX8 Protein, Human (His) is 145 a.a., with molecular weight of ~16 kDa.

The PAX8 protein operates as a transcription factor essential for the thyroid-specific expression of genes exclusive to thyroid cells, thereby preserving the functional differentiation of these cells. PAX8 plays a pivotal role in regulating the thyroid-specific gene expression profile, contributing to the specialized function of thyroid cells. Additionally, PAX8 interacts with WWTR1, suggesting a potential partnership in modulating gene expression and cellular processes within the thyroid cell type.

Human

E. coli

C-His

Q06710 (P2-S146)

7849  [NCBI]

PHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDS

Approximately 17 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4, 10% glycerol or PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.