PCSK9 Protein, Macaca nemestrina (HEK293, His)

The PCSK9 protein controls plasma cholesterol levels by interacting with LDLR, VLDLR, LRP1/APOER, and LRP8/APOER2 to promote their degradation. It prevents LDLR recycling and directs it to lysosomes for degradation. PCSK9 induces LDLR ubiquitination, inhibits APOB degradation, disposes of BACE1 intermediates, reduces ENaC surface expression, and regulates neuronal apoptosis through LRP8/APOER2. PCSK9 Protein, Macaca nemestrina (HEK293, His) is a recombinant protein dimer complex containing cynomolgus-derived PCSK9 protein, expressed by HEK293 , with C-6*His labeled tag. PCSK9 Protein, Macaca nemestrina (HEK293, His), has molecular weight of (16-21) & (55-77) kDa, respectively.

PCSK9 protein plays a crucial role in maintaining the balance of plasma cholesterol levels. It interacts with low-density lipoprotein receptor family members such as LDLR, VLDLR, LRP1/APOER, and LRP8/APOER2, promoting their degradation within acidic compartments of the cell. Through a non-proteolytic mechanism, it enhances the degradation of hepatic LDLR via a clathrin LDLRAP1/ARH-mediated pathway, preventing its recycling from endosomes to the cell surface and directing it to lysosomes for degradation. Additionally, PCSK9 can induce ubiquitination of LDLR, leading to its subsequent degradation. It also inhibits the intracellular degradation of APOB, independent of LDLR, by affecting the autophagosome/lysosome pathway. Moreover, PCSK9 is involved in the early secretory pathway by disposing of non-acetylated intermediates of BACE1. It further regulates epithelial Na(+) channel (ENaC)-mediated Na(+) absorption by reducing ENaC surface expression, primarily through increased proteasomal degradation. Finally, PCSK9 modulates neuronal apoptosis by regulating the levels of LRP8/APOER2 and related anti-apoptotic signaling pathways.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Cynomolgus

HEK293

C-6*His

A8T662 (Q31-Q152&S153-Q692)

105495119  [NCBI]

QEDEDGDYEELVLALRSEEDGLADAPEHGATATFHRCAKDPWRLPGTYVVVLKEETHRSQSERTARRLQAQAARRGYLTKILHVFHHLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ&SIPWNLERITPARYRADEYQPPKGGSLVEVYLLDTSIQSDHREIEGRVMVTDFESVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDAGVAKGAGLRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVFNAACQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSDCSTCFVSRSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAALPPSTHRAGWQLFCRTVWSAHSGPTRMATAVARCAQDEELLSCSSFSRSGKRRGERIEAQGGKRVCRAHNAFGGEGVYAIARCCLLPQVNCSVHTAPPAGASMGTRVHCHQQGHVLTGCSSHWEVEDLGTHKPPVLRPRGQPNQCVGHREASIHASCCHAPGLECKVKEHGIPAPQEQVIVACEDGWTLTGCSALPGTSHVLGAYAVDNTCVVRSRDVSTTGSTSEEAVAAVAICCRSRHLVQASQELQ

(16-21)&(55-77) kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, 0.1 M Arg, 0.1 M Glu, 20% glycerol, 0.01% tween20, 5% Trehalose, pH 6.0.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.