PCSK9 Protein, Rat (HEK293, His)

The PCSK9 protein regulates cholesterol levels by interacting with LDLR, VLDLR, LRP1/APOER, and LRP8/APOER2. It promotes their degradation and inhibits their recycling, leading to enhanced LDLR degradation. PCSK9 also affects APOB degradation, BACE1 intermediates, ENaC surface expression, and neuronal apoptosis via LRP8/APOER2. PCSK9 Protein, Rat (HEK293, His) is the recombinant rat-derived PCSK9 protein, expressed by HEK293 , with C-6*His labeled tag.

The PCSK9 protein plays a pivotal role in the regulation of plasma cholesterol homeostasis, exerting its influence through interactions with members of the low-density lipid receptor family, including low-density lipoprotein receptor (LDLR), very low-density lipoprotein receptor (VLDLR), apolipoprotein E receptor (LRP1/APOER), and apolipoprotein receptor 2 (LRP8/APOER2). PCSK9 facilitates the degradation of these receptors within intracellular acidic compartments, employing a non-proteolytic mechanism to enhance hepatic LDLR degradation via a clathrin LDLRAP1/ARH-mediated pathway. Additionally, it may impede LDLR recycling from endosomes to the cell surface, directing it to lysosomes for degradation, and induce ubiquitination of LDLR, leading to subsequent degradation. Notably, PCSK9 extends its regulatory influence beyond LDLR, inhibiting the intracellular degradation of APOB independently of LDLR, and participating in the disposal of non-acetylated intermediates of BACE1 in the early secretory pathway. Furthermore, PCSK9's impact extends to epithelial Na(+) channel (ENaC)-mediated Na(+) absorption, reducing ENaC surface expression primarily through increased proteasomal degradation. The protein also modulates neuronal apoptosis by regulating LRP8/APOER2 levels and associated anti-apoptotic signaling pathways.

1.The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
2.Measured by its binding ability in a functional ELISA. When Recombinant Human LDLR is coated at 5 µg/mL can bind Recombinant Rat PCSK9. The ED₅₀ for this effect is 0.2335 μg/mL.

Rat

HEK293

C-6*His

P59996 (Q31-Q691)

298296  [NCBI]

QDEDGDYEELMLALPSQEDSLVDEASHVATATFRRCSKEAWRLPGTYVVVLMEETQRLQVEQTAHRLQTWAARRGYVIKVLHVFYDLFPGFLVKMSSDLLGLALKLPHVEYIEEDSLVFAQSIPWNLRIIPAWQQTEEDSSPDGSSQVEVYLLDTSIQSGHREIEGRVTITDFNSVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDAGVAKGTSLHSLRVLNCQGKGTVSGTLIGLEFIRKSQLIQPSGPLVVLPLAGGYSRILNTACQRLARTGVVLVAAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGKDIIGASSDCSTCYMSQSGTSQAAAHVAGIVAMMLNRDPALTLAELRQRILFSTKDVINMAWFPEDQRVLTPNRVATLPPSTQETGGQLLCRTVWSAHSGPTRTATATARCAPEEELLSCSSFSRSGRRRGDRIEAIGGQQVCKALNAFGGEGVYAVARCCLLPRVNCSIHNTPAAAGPQTPVHCHQKDHVLTGCSFHWEVENLRAQQQPLLRSRHQPGQCVGHQEASVHASCCHAPGLECKIKEHGIAGPAEQVTVACEAGWTLTGCNVLPGASLPLGAYSVDNVCVARIRDAGRADRTSEETVAAAICCRSRPSAKASWVHQ

Approximately 17.26 & 60.16kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.8.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.