1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. PCSK9 Protein, Rat (HEK293, His)

The PCSK9 protein regulates cholesterol levels by interacting with LDLR, VLDLR, LRP1/APOER, and LRP8/APOER2. It promotes their degradation and inhibits their recycling, leading to enhanced LDLR degradation. PCSK9 also affects APOB degradation, BACE1 intermediates, ENaC surface expression, and neuronal apoptosis via LRP8/APOER2. PCSK9 Protein, Rat (HEK293, His) is the recombinant rat-derived PCSK9 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE PCSK9 Protein, Rat (HEK293, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PCSK9 protein regulates cholesterol levels by interacting with LDLR, VLDLR, LRP1/APOER, and LRP8/APOER2. It promotes their degradation and inhibits their recycling, leading to enhanced LDLR degradation. PCSK9 also affects APOB degradation, BACE1 intermediates, ENaC surface expression, and neuronal apoptosis via LRP8/APOER2. PCSK9 Protein, Rat (HEK293, His) is the recombinant rat-derived PCSK9 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The PCSK9 protein plays a pivotal role in the regulation of plasma cholesterol homeostasis, exerting its influence through interactions with members of the low-density lipid receptor family, including low-density lipoprotein receptor (LDLR), very low-density lipoprotein receptor (VLDLR), apolipoprotein E receptor (LRP1/APOER), and apolipoprotein receptor 2 (LRP8/APOER2). PCSK9 facilitates the degradation of these receptors within intracellular acidic compartments, employing a non-proteolytic mechanism to enhance hepatic LDLR degradation via a clathrin LDLRAP1/ARH-mediated pathway. Additionally, it may impede LDLR recycling from endosomes to the cell surface, directing it to lysosomes for degradation, and induce ubiquitination of LDLR, leading to subsequent degradation. Notably, PCSK9 extends its regulatory influence beyond LDLR, inhibiting the intracellular degradation of APOB independently of LDLR, and participating in the disposal of non-acetylated intermediates of BACE1 in the early secretory pathway. Furthermore, PCSK9's impact extends to epithelial Na(+) channel (ENaC)-mediated Na(+) absorption, reducing ENaC surface expression primarily through increased proteasomal degradation. The protein also modulates neuronal apoptosis by regulating LRP8/APOER2 levels and associated anti-apoptotic signaling pathways.

Biological Activity

1.The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
2.Measured by its binding ability in a functional ELISA. When Recombinant Human LDLR is coated at 5 µg/mL can bind Recombinant Rat PCSK9. The ED50 for this effect is 0.2335 μg/mL.

  • Measured by its binding ability in a functional ELISA. When Recombinant Human LDLR is coated at 5 µg/mL can bind Recombinant Rat PCSK9. The ED50 for this effect is 0.2335 μg/mL.
Species

Rat

Source

HEK293

Tag

C-6*His

Accession

P59996 (Q31-Q691)

Gene ID
Molecular Construction
N-term
PCSK9 (Q31-Q691)
Accession # P59996
6*His
C-term
Synonyms
Proprotein convertase subtilisin/kexin type 9; NARC-1; PC9; PCSK9
AA Sequence

QDEDGDYEELMLALPSQEDSLVDEASHVATATFRRCSKEAWRLPGTYVVVLMEETQRLQVEQTAHRLQTWAARRGYVIKVLHVFYDLFPGFLVKMSSDLLGLALKLPHVEYIEEDSLVFAQSIPWNLRIIPAWQQTEEDSSPDGSSQVEVYLLDTSIQSGHREIEGRVTITDFNSVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDAGVAKGTSLHSLRVLNCQGKGTVSGTLIGLEFIRKSQLIQPSGPLVVLPLAGGYSRILNTACQRLARTGVVLVAAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGKDIIGASSDCSTCYMSQSGTSQAAAHVAGIVAMMLNRDPALTLAELRQRILFSTKDVINMAWFPEDQRVLTPNRVATLPPSTQETGGQLLCRTVWSAHSGPTRTATATARCAPEEELLSCSSFSRSGRRRGDRIEAIGGQQVCKALNAFGGEGVYAVARCCLLPRVNCSIHNTPAAAGPQTPVHCHQKDHVLTGCSFHWEVENLRAQQQPLLRSRHQPGQCVGHQEASVHASCCHAPGLECKIKEHGIAGPAEQVTVACEAGWTLTGCNVLPGASLPLGAYSVDNVCVARIRDAGRADRTSEETVAAAICCRSRPSAKASWVHQ

Molecular Weight

Approximately 17.26 & 60.16kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.8.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PCSK9 Protein, Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PCSK9 Protein, Rat (HEK293, His)
Cat. No.:
HY-P73340
Quantity:
MCE Japan Authorized Agent: