1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Inhibitory Checkpoint Molecules T Cell CD Proteins Macrophage CD Proteins
  4. PD-1
  5. PD-1 Protein, Mouse (HEK293, His-Fc)

PD-1 Protein, Mouse (HEK293, His-Fc)

Cat. No.: HY-P73724
COA Handling Instructions

PD-1 (programmed cell death 1) protein negatively regulates immune responses and affects processes such as apoptosis and tolerance induction. It is a transmembrane protein found on the outside of the plasma membrane and expressed in the retina. PD-1 Protein, Mouse (HEK293, His-Fc) is the recombinant mouse-derived PD-1 protein, expressed by HEK293 , with C-hFc, C-8*His labeled tag. The total length of PD-1 Protein, Mouse (HEK293, His-Fc) is 143 a.a., with molecular weight of 60-65 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $70 In-stock
10 μg $119 In-stock
50 μg $332 In-stock
100 μg $565 In-stock
200 μg $960 Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE PD-1 Protein, Mouse (HEK293, His-Fc)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PD-1 (programmed cell death 1) protein negatively regulates immune responses and affects processes such as apoptosis and tolerance induction. It is a transmembrane protein found on the outside of the plasma membrane and expressed in the retina. PD-1 Protein, Mouse (HEK293, His-Fc) is the recombinant mouse-derived PD-1 protein, expressed by HEK293 , with C-hFc, C-8*His labeled tag. The total length of PD-1 Protein, Mouse (HEK293, His-Fc) is 143 a.a., with molecular weight of 60-65 kDa.

Background

PD-1 (Programmed Cell Death 1) protein plays a crucial role in the negative regulation of the immune response, acting upstream of processes such as the negative regulation of apoptotic processes, negative regulation of tolerance induction, and positive regulation of apoptotic processes. This transmembrane protein is located on the external side of the plasma membrane and is expressed in the retina. PD-1 is associated with various diseases, including autoimmune diseases, hepatitis B and C, hepatocellular carcinoma, and lupus nephritis. The biased expression of PD-1 in adult thymus and ovary suggests its involvement in immune regulation within these tissues.

Biological Activity

1. Determined by its ability to prevent plate adhesion of PHA-stimulated Jurkat cells in the presence of 625 ng/mL of bound hPD-L1. The ED50 for this effect is 0.4262 μg/mL, corresponding to a specific activity is 2.35×103 units/mg.
2. Immobilized Recombinant Mouse PD-1 at 1 μg/ml (100 μl/well) can bind Recombinant Mouse PD-L1. The ED50 for this effect is 0.5001 μg/mL.

  • Determined by its ability to prevent plate adhesion of PHA-stimulated Jurkat cells in the presence of 625ng/mL of bound hPD-L1. The ED50 for this effect is 0.4262 μg/mL, corresponding to a specific activity is 2.35×103 units/mg.
Species

Mouse

Source

HEK293

Tag

C-hFc;C-8*His

Accession

NP_032824.1 (L25-Q167)

Gene ID
Synonyms
Programmed cell death protein 1; PD1; CD279; PDCD1
AA Sequence

LEVPNGPWRSLTFYPAWLTVSEGANATFTCSLSNWSEDLMLNWNRLSPSNQTEKQAAFCNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGIYLCGAISLHPKAKIEESPGAELVVTERILETSTRYPSPSPKPEGRFQ

Molecular Weight

60-65 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 (Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.) or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PD-1 Protein, Mouse (HEK293, His-Fc)
Cat. No.:
HY-P73724
Quantity:
MCE Japan Authorized Agent: