PD-1 Protein, Mouse (HEK293, His-Fc)

PD-1 (programmed cell death 1) protein negatively regulates immune responses and affects processes such as apoptosis and tolerance induction. It is a transmembrane protein found on the outside of the plasma membrane and expressed in the retina. PD-1 Protein, Mouse (HEK293, His-Fc) is the recombinant mouse-derived PD-1 protein, expressed by HEK293 , with C-hFc, C-8*His labeled tag.

PD-1 (Programmed Cell Death 1) protein plays a crucial role in the negative regulation of the immune response, acting upstream of processes such as the negative regulation of apoptotic processes, negative regulation of tolerance induction, and positive regulation of apoptotic processes. This transmembrane protein is located on the external side of the plasma membrane and is expressed in the retina. PD-1 is associated with various diseases, including autoimmune diseases, hepatitis B and C, hepatocellular carcinoma, and lupus nephritis. The biased expression of PD-1 in adult thymus and ovary suggests its involvement in immune regulation within these tissues.

1. Determined by its ability to prevent plate adhesion of PHA-stimulated Jurkat cells in the presence of 625 ng/mL of bound hPD-L1. The ED₅₀ for this effect is 0.4262 μg/mL, corresponding to a specific activity is 2.35×10³ units/mg.
2. Immobilized Recombinant Mouse PD-1 at 1 μg/ml (100 μl/well) can bind Recombinant Mouse PD-L1. The ED50 for this effect is 0.5001 μg/mL.

• 
  Determined by its ability to prevent plate adhesion of PHA-stimulated Jurkat cells in the presence of 625ng/mL of bound hPD-L1. The ED₅₀ for this effect is 0.4262 μg/mL, corresponding to a specific activity is 2.35×10³ units/mg.

Mouse

HEK293

C-hFc;C-8*His

NP_032824.1 (L25-Q167)

18566  [NCBI]

LEVPNGPWRSLTFYPAWLTVSEGANATFTCSLSNWSEDLMLNWNRLSPSNQTEKQAAFCNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGIYLCGAISLHPKAKIEESPGAELVVTERILETSTRYPSPSPKPEGRFQ

60-65 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 (Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.) or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.