PD-L1 Protein, Rat (HEK293, Fc)

PD-L1 (Programmed death-ligand 1) critically regulates T cell proliferation and migration, acting as a biomarker for periodontitis and pre-eclampsia. CD274 is its human ortholog. Biased expression in the thymus (RPKM 102.9), spleen (RPKM 58.3), and other tissues emphasizes PD-L1's centrality in immune regulation across diverse physiological and pathological conditions. PD-L1 Protein, Rat (HEK293, Fc) is the recombinant rat-derived PD-L1 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of PD-L1 Protein, Rat (HEK293, Fc) is 221 a.a., with molecular weight of ~63 kDa.

Programmed death-ligand 1 (PD-L1) plays a critical role in the positive regulation of T cell proliferation and cell migration. Situated on the cell surface, PD-L1 serves as a biomarker for conditions such as periodontitis and pre-eclampsia. Its orthologous counterpart in humans is CD274 (CD274 molecule). With biased expression observed in the thymus (RPKM 102.9), spleen (RPKM 58.3), and various other tissues, PD-L1 is central to immune regulation and holds significance in the context of diverse physiological and pathological conditions.

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL‑2 mouse cytotoxic T cells. The ED ₅₀ this effect is 0.2157 μg/mL in the presence of 10 μg/mL anti-CD3, corresponding to a specific activity is 4.64×10³ units/mg.

• 
  Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL‑2 mouse cytotoxic T cells. The ED₅₀ for this effect is 0.2157 μg/mL in the presence of 10 μg/mL anti-CD3, corresponding to a specific activity is 4.64×10³ units/mg.

Rat

HEK293

C-hFc

NP_001178883.1 (A18-T238)

499342  [NCBI]

AFTITAPKDLYVVEYGSNVTMECRFPVEQKLDLLALVVYWEKEDKEVIQFVEGEEDLKPQHSSFRGRAFLPKDQLLKGNAVLQITDVKLQDAGVYCCMISYGGADYKRITLKVNAPYRKINQRISMDPATSEHELMCQAEGYPEAEVIWTNSDHQSLSGETTVTTSQTEEKLLNVTSVLRVNATANDVFHCTFWRVHSGENHTAELIIPELPVPRLPHNRT

Approximately 63 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.