PDCD10 Protein, Human

The PDCD10 protein is a multifunctional regulator that plays a key role in cell proliferation, apoptosis regulation, and enhanced kinase activity. It is essential for cell migration, Golgi complex assembly and KDR/VEGFR2 signaling stability, affecting embryonic development, cardiovascular development, vasculogenesis, vasculogenesis and hematopoiesis. PDCD10 Protein, Human is the recombinant human-derived PDCD10 protein, expressed by E. coli , with tag free. The total length of PDCD10 Protein, Human is 212 a.a., with molecular weight of ~28.0 kDa.

PDCD10 Protein emerges as a multifunctional regulator, exerting its influence on diverse cellular processes. Notably, it plays a pivotal role in promoting cell proliferation, modulating apoptotic pathways, and enhancing mitogen-activated protein kinase activity and STK26 activity. Beyond its involvement in cell cycle dynamics, PDCD10 is essential for cell migration, contributing to the normal structure and assembly of the Golgi complex. Furthermore, it proves critical for KDR/VEGFR2 signaling by increasing the stability of KDR/VEGFR2 and preventing its breakdown. PDCD10's significance extends to embryonic development, where it is required for normal cardiovascular development, angiogenesis, vasculogenesis, and hematopoiesis. Operating as a homodimer, PDCD10 engages in a network of protein-protein interactions, including associations with CCM2, PXN, STK25, STK26, STK24, GOLGA2, and KDR/VEGFR2, highlighting its intricate involvement in cellular signaling pathways and structural processes. The intricate interplay of PDCD10 in these molecular networks underscores its versatile role in cellular homeostasis and warrants further investigation to unravel the detailed mechanisms governing its diverse functions.

Human

E. coli

Tag Free

Q9BUL8 (M1-Al212 )

11235  [NCBI]

MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA

Approximately 28.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.