PDGF-AA Protein, Human (His)

PDGF-AA Protein, Human (His) is a member of PDGF family, binds to FDGFR, and may has the potential to enhance wound healing.

Platelet-Derived Growth Factor-AA is a member of PDGF family, which promotes cell proliferation, survival and migration, through binding to the tyrosine kinase PDGF receptor^[1]. PDGF-AA may play a crucial role in the ability of ASCs and EPCs to enhance wound healing, especially in animal models with wound-healing deficits^[2].

Measured in a cell proliferation assay using NIH-3T3 mouse fibroblast cells. The ED₅₀ for this effect is 53.43 ng/mL, corresponding to a specific activity is 1.87×10⁴ units/mg.

• 
  Measured in a cell proliferation assay using NIH-3T3 mouse fibroblast cells. The ED₅₀ for this effect is 53.43 ng/mL, corresponding to a specific activity is 1.87×10⁴ units/mg.

Human

E. coli

N-6*His

P04085-1 (S87-T211)

5154  [NCBI]

SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT

16-18 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 4 mM HCL or 50 mM Tris-HCL, 300 mM NaCl, 200 mM arginine, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Zhao F, et, al. Effect of platelet-derived growth factor-BB on gap junction and connexin43 in rat penile corpus cavernosum smooth muscle cells. Andrologia. 2019 Apr;51(3):e13200.  [Content Brief]

  [2]. Wu LW, et, al. Platelet-derived growth factor-AA is a substantial factor in the ability of adipose-derived stem cells and endothelial progenitor cells to enhance wound healing. FASEB J. 2019 Feb;33(2):2388-2395.  [Content Brief]