1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. PDGFs & PDGFRs
  4. PDGF
  5. PDGF-AA
  6. PDGF-AA Protein, Human

PDGF-AA Protein, Human

Cat. No.: HY-P70598
SDS COA Handling Instructions

PDGF-A protein is a key growth factor that regulates embryonic development, cell proliferation, migration, survival, and chemotaxis, and exerts potent mitogenic effects on mesenchymal cells. It is essential for alveolar septal formation, gastrointestinal tract development, interstitial cell maturation, spermatogenesis, and oligodendrocyte development, and contributes to spinal cord and cerebellar myelination. PDGF-AA Protein, Human is the recombinant human-derived PDGF-AA protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $65 In-stock
10 μg $170 In-stock
50 μg $510 In-stock
100 μg $850 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

PDGF-AA Protein, Human Featured Recommendations:

Top Publications Citing Use of Products

Publications Citing Use of MCE PDGF-AA Protein, Human

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PDGF-A protein is a key growth factor that regulates embryonic development, cell proliferation, migration, survival, and chemotaxis, and exerts potent mitogenic effects on mesenchymal cells. It is essential for alveolar septal formation, gastrointestinal tract development, interstitial cell maturation, spermatogenesis, and oligodendrocyte development, and contributes to spinal cord and cerebellar myelination. PDGF-AA Protein, Human is the recombinant human-derived PDGF-AA protein, expressed by E. coli , with tag free.

Background

PDGF-A Protein takes center stage as a pivotal growth factor regulating embryonic development, cell proliferation, migration, survival, and chemotaxis. Acknowledged for its potent mitogenic effects on mesenchymal cells, PDGF-A is indispensable for various developmental processes, including the formation of lung alveolar septa, gastrointestinal tract development, Leydig cell maturation, spermatogenesis, and the normal development of oligodendrocytes, contributing to myelination in the spinal cord and cerebellum. Furthermore, PDGF-A assumes a crucial role in wound healing dynamics. The intricacies of its signaling pathway involve modulation through the formation of heterodimers with PDGFB, demonstrating its regulatory versatility. Structurally, PDGF-A adopts a homodimeric configuration with an antiparallel disulfide-linked dimer, and it forms heterodimers with PDGFB, engaging in interactions with PDGFRA homodimers and heterodimers formed by PDGFRA and PDGFRB. Additionally, PDGF-A exhibits an interaction with CSPG4, adding another layer to its multifaceted involvement in cellular processes.

Biological Activity

Measured  in a cell proliferation assay using Balb/c 3T3 mouse fibroblast cells. The  ED50 for this effect is 3.691-7.548 ng/mL.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P04085-1 (S87-T211)

Gene ID
Molecular Construction
N-term
PDGF-AA (S87-T211)
Accession # P04085-1
C-term
Synonyms
PDGFAA; PDGF-AA
AA Sequence

SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT

Molecular Weight

Approximately 17-18 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Glycine-HCl, 6% Sucrose, 4% Mannitol, 0.02% Tween 80, pH 3.0 or 50 mM Tris-HCL, 300 mM NaCl, 200 mM arginine, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PDGF-AA Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PDGF-AA Protein, Human
Cat. No.:
HY-P70598
Quantity:
MCE Japan Authorized Agent: