PDGF-AA Protein, Human

PDGF-A protein is a key growth factor that regulates embryonic development, cell proliferation, migration, survival, and chemotaxis, and exerts potent mitogenic effects on mesenchymal cells. It is essential for alveolar septal formation, gastrointestinal tract development, interstitial cell maturation, spermatogenesis, and oligodendrocyte development, and contributes to spinal cord and cerebellar myelination. PDGF-AA Protein, Human is the recombinant human-derived PDGF-AA protein, expressed by E. coli , with tag free.

PDGF-A Protein takes center stage as a pivotal growth factor regulating embryonic development, cell proliferation, migration, survival, and chemotaxis. Acknowledged for its potent mitogenic effects on mesenchymal cells, PDGF-A is indispensable for various developmental processes, including the formation of lung alveolar septa, gastrointestinal tract development, Leydig cell maturation, spermatogenesis, and the normal development of oligodendrocytes, contributing to myelination in the spinal cord and cerebellum. Furthermore, PDGF-A assumes a crucial role in wound healing dynamics. The intricacies of its signaling pathway involve modulation through the formation of heterodimers with PDGFB, demonstrating its regulatory versatility. Structurally, PDGF-A adopts a homodimeric configuration with an antiparallel disulfide-linked dimer, and it forms heterodimers with PDGFB, engaging in interactions with PDGFRA homodimers and heterodimers formed by PDGFRA and PDGFRB. Additionally, PDGF-A exhibits an interaction with CSPG4, adding another layer to its multifaceted involvement in cellular processes.

Measured  in a cell proliferation assay using Balb/c 3T3 mouse fibroblast cells. The  ED₅₀ for this effect is 3.691 ng/mL, corresponding to a specific  activity is 2.701×10⁵ units/mg.

Human

E. coli

Tag Free

P04085-1 (S87-T211)

5154  [NCBI]

SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT

Approximately 17.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM Glycine-HCl, 6% Sucrose, 4% Mannitol, 0.02% Tween 80, pH 3.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.