PDGF-AA Protein, Mouse

PDGF-AA Protein, Mouse is a member of PDGF family, binds to FDGFR, and may has the potential to enhance wound healing.

Platelet-Derived Growth Factor-AA is a member of PDGF family, which promotes cell proliferation, survival and migration, through binding to the tyrosine kinase PDGF receptor^[1]. PDGF-AA may play a crucial role in the ability of ASCs and EPCs to enhance wound healing, especially in animal models with wound-healing deficits^[2].

The ED₅₀ is <50 ng/mL as measured by 3T3 cells.

• 
  Measured in a cell proliferation assay using Balb/c 3T3 cells . The ED₅₀ for this effect is 4.207 ng/mL, corresponding to a specific activity is 2.377×10⁵units/mg.

Mouse

E. coli

Tag Free

P20033 (S87-T211)

18590  [NCBI]

SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATSNLNPDHREEETGRRRESGKNRKRKRLKPT

Approximately 17-28.7 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized after extensive dialysis against PBS, pH 7.4 or 50 mM Tris-HCL, 300 mM NaCl, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Zhao F, et al. Effect of platelet-derived growth factor-BB on gap junction and connexin43 in rat penile corpus cavernosum smooth muscle cells. Andrologia. 2018 Nov 23:e13200.  [Content Brief]

  [2]. Wu LW, et al. Platelet-derived growth factor-AA is a substantial factor in the ability of adipose-derived stem cells and endothelial progenitor cells to enhance wound healing. FASEB J. 2018 Sep 28:fj201800658R.  [Content Brief]