1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. PDGFs & PDGFRs
  4. PDGF
  5. PDGF-BB
  6. PDGF-BB Protein, Human (His)

The PDGF-BB protein is a key growth factor that centrally regulates embryonic development, cell proliferation, migration, survival, and chemotaxis. It is known for its potent mitogenic effects on mesenchymal cells and is essential for the normal proliferation and recruitment of pericytes and vascular smooth muscle cells in tissues such as the central nervous system, skin, lungs, heart, and placenta. PDGF-BB Protein, Human (His) is the recombinant human-derived PDGF-BB protein, expressed by E. coli , with N-6*His labeled tag. The total length of PDGF-BB Protein, Human (His) is 109 a.a., with molecular weight of approximately 15 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample (2 μg)   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PDGF-BB protein is a key growth factor that centrally regulates embryonic development, cell proliferation, migration, survival, and chemotaxis. It is known for its potent mitogenic effects on mesenchymal cells and is essential for the normal proliferation and recruitment of pericytes and vascular smooth muscle cells in tissues such as the central nervous system, skin, lungs, heart, and placenta. PDGF-BB Protein, Human (His) is the recombinant human-derived PDGF-BB protein, expressed by E. coli , with N-6*His labeled tag. The total length of PDGF-BB Protein, Human (His) is 109 a.a., with molecular weight of approximately 15 kDa.

Background

GMP PDGF-BB Protein, a pivotal growth factor, assumes a central role in regulating embryonic development, cell proliferation, migration, survival, and chemotaxis. Renowned for its potent mitogenic effects on mesenchymal cells, GMP PDGF-BB is indispensable for the normal proliferation and recruitment of pericytes and vascular smooth muscle cells in various tissues, including the central nervous system, skin, lung, heart, and placenta. Its vital contributions extend to the development of blood vessels and kidney glomeruli, highlighting its significance in vascular and renal physiology. A key participant in wound healing, GMP PDGF-BB's signaling dynamics are finely tuned through heterodimer formation with PDGFA. Present as an antiparallel homodimer, GMP PDGF-BB engages in disulfide-linked interactions with PDGFRA and PDGFRB homodimers, as well as with heterodimers formed by PDGFRA and PDGFRB. Additionally, it forms antiparallel heterodimers with PDGFA, further diversifying its regulatory repertoire. Notably, GMP PDGF-BB establishes connections with XLKD1, LRP1, and SORL1, contributing to a network of interactions that modulate its multifaceted functions.

Biological Activity

Measured in a cell proliferation assay using NIH3T3 mouse fibroblast cells. The ED50 for this effect is ≤5.712 ng/mL, corresponding to a specific activity is ≥1.751×105 units/mg.

  • Measured in a cell proliferation assay using NIH3T3 mouse fibroblast cells. The ED50 for this effect is 5.712 ng/mL, corresponding to a specific activity is 1.751×105 units/mg.
Species

Human

Source

E. coli

Tag

N-6*His

Accession

P01127-1 (S82-T190)

Gene ID
Molecular Construction
N-term
6*His
PDGF-BB (S82-T190)
Accession # P01127
C-term
Synonyms
rHuPDGF-BB; PDGF-2; GDGF; ODGF; SIS; SSV
AA Sequence

SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT

Molecular Weight

approximately 15 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, 200 mM arginine, pH 8.0 or 50 mM Tris-HCL, 300 mM NaCl, 200 mM arginine, pH 8.0, 5% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PDGF-BB Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PDGF-BB Protein, Human (His)
Cat. No.:
HY-P7055B
Quantity:
MCE Japan Authorized Agent: