PDGF-BB Protein, Human (P.pastoris)

PDGF-BB Protein, Human (P.pastoris) is the most active PDGF isoform, binds to PDGF receptor, promotes diverse cell types proliferation and osteogenesis, and further stimulates bone formation in fracture or defect.

Recombinant Human Platelet-derived Growth Factor-BB (P.pastoris-expressed) is the most active PDGF isoform, binds to PDGF receptor, promotes diverse cell types proliferation and osteogenesis, and further stimulates bone formation in fracture or defect. Platelet-derived growth factor-BB (PDGF-BB) is primarily secreted from platelet α-granules and is the most active PDGF isoform in bone and other connective tissue as it can bind to all known PDGF receptors. PDGF-BB plays an important role in bone regeneration by inducing mitogenesis, chemotaxis, extracellular matrix formation, and vascularization^[1]. Recombinant Human Platelet-derived Growth Factor-BB (rhPDGF-BB) accelerates tendon healing by improving matrix remodeling, increased collagen synthesis, and increased cell proliferation. Recombinant Human Platelet-derived Growth Factor-BB is also efficacious in a non-ruptured, degenerated, tendinopathy model. Furthermore, Recombinant Human Platelet-derived Growth Factor-BB addresses chronic tendinopathies by inducing proliferation and migration of progenitor cells and tenocytes, which stimulate structural repair of the degenerated tendon^[2].

The ED₅₀ is <3 ng/mL as measured by Balb/c 3T3 cells, corresponding to a specific activity of >3.3 × 10⁵ units/mg.

Human

P. pastoris

Tag Free

P01127 (S82-T190)

5155  [NCBI]

SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT

Approximately 24.3 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against 10 mM acetic acid.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Sun H, et al. Recombinant human platelet-derived growth factor-BB versus autologous bone graft in foot and ankle fusion: A systematic review and meta-analysis. Foot Ankle Surg. 2017 Mar;23(1):32-39.  [Content Brief]

  [2]. Solchaga LA, et al. Comparison of the effect of intra-tendon applications of recombinant human platelet-derived growth factor-BB, platelet-rich plasma, steroids in a rat achilles tendon collagenase model. J Orthop Res. 2014 Jan;32(1):145-50.  [Content Brief]