PDGF-BB Protein, Human

PDGF-BB Protein, Human is the most active PDGF isoform, binds to PDGF receptor, promotes diverse cell types proliferation and osteogenesis, and further stimulates bone formation in fracture or defect.

Recombinant Human Platelet-derived Growth Factor-BB is the most active PDGF isoform, binds to PDGF receptor, promotes diverse cell types proliferation and osteogenesis, and further stimulates bone formation in fracture or defect. Platelet-derived growth factor-BB (PDGF-BB) is primarily secreted from platelet α-granules and is the most active PDGF isoform in bone and other connective tissue as it can bind to all known PDGF receptors. PDGF-BB plays an important role in bone regeneration by inducing mitogenesis, chemotaxis, extracellular matrix formation, and vascularization^[1]. Recombinant Human Platelet-derived Growth Factor-BB (rhPDGF-BB) accelerates tendon healing by improving matrix remodeling, increased collagen synthesis, and increased cell proliferation. Recombinant Human Platelet-derived Growth Factor-BB is also efficacious in a non-ruptured, degenerated, tendinopathy model. Furthermore, Recombinant Human Platelet-derived Growth Factor-BB addresses chronic tendinopathies by inducing proliferation and migration of progenitor cells and tenocytes, which stimulate structural repair of the degenerated tendon^[2].

The ED₅₀ is <42 ng/mL as measured by murine Balb/c 3T3 cells.

Human

E. coli

Tag Free

P01127-1 (S82-T190)

5155  [NCBI]

SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT

Approximately 13 kDa in reducing condition; 24.8 kDa in non-reducing condition.

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized after extensive dialysis against PBS, pH 7.4 or 20 mM NaAc-HAc, pH 4.5 or 50 mM Tris-HCL, 200 mM NaCl, 200 mM arginine, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Sun H, et al. Recombinant human platelet-derived growth factor-BB versus autologous bone graft in foot and ankle fusion: A systematic review and meta-analysis. Foot Ankle Surg. 2017 Mar;23(1):32-39.  [Content Brief]

  [2]. Solchaga LA, et al. Comparison of the effect of intra-tendon applications of recombinant human platelet-derived growth factor-BB, platelet-rich plasma, steroids in a rat achilles tendon collagenase model. J Orthop Res. 2014 Jan;32(1):145-50.  [Content Brief]