PDGF-CC Protein, Human (HEK293, Fc)

PDGF-CC is a multifunctional growth factor that plays a crucial role in embryonic development, cellular processes, and tissue formation. It is essential for embryonic skeletal development, skin morphogenesis, and wound healing. PDGF-CC Protein, Human (HEK293, Fc) is the recombinant human-derived PDGF-CC protein, expressed by HEK293 , with N-hFc labeled tag.

PDGF-CC, a multifaceted growth factor, assumes a pivotal role in orchestrating diverse cellular processes, including embryonic development, cell proliferation, migration, survival, and chemotaxis. As a potent mitogen and chemoattractant for mesenchymal cells, PDGF-CC is indispensable for the normal formation of the embryonic skeleton, particularly the craniofacial skeleton and palate. Its significance extends to skin morphogenesis during embryonic development and holds a critical position in wound healing, guiding the intricate stages of inflammation, proliferation, and remodeling. Moreover, PDGF-CC emerges as a key player in angiogenesis, blood vessel development, and fibrotic processes, where it contributes to the transformation of interstitial fibroblasts into myofibroblasts and collagen deposition. Beyond its role in maintaining PDGF domain latency, the CUB domain exhibits mitogenic activity in coronary artery smooth muscle cells. Intriguingly, within the nucleus, PDGF-CC appears to serve additional functions. Structurally, PDGF-CC forms homodimers linked by disulfide bonds and engages in interactions with PDGFRA homodimers, as well as heterodimers formed by PDGFRA and PDGFRB, highlighting its intricate involvement in a myriad of cellular activities. The CUB domain of PDGF-CC further interacts with PLAT, emphasizing its diverse and dynamic roles in cellular regulation.

Human

HEK293

N-hFc

Q9NRA1-1 (V235-G345)

56034  [NCBI]

VVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG

Approximately 45 kDa

Greater than 95% as determined by reducing SDS-PAGE

<1 EU/μg, determined by LAL method.