PDGF-CC Protein, Human (HEK293)

PDGF-CC Protein, Human (HEK293) is a member of the PDGF family, binds to PDGFR-α and PDGFR-β and acts as potent angiogenic factor.

PDGF-CC is a relatively new member of the PDGF family, abundantly expressed by different types of cells, such as tumor cells, endothelial cells (ECs), vascular smooth muscle cells (VSMCs), pericytes, fibroblasts, and macrophages. PDGF-CC binds to PDGFR-α and PDGFR-β, which are also expressed by many different cell types, including tumor cells, VSMCs, pericytes, and fibroblasts, all of which play important roles in angiogenesis. PDGF-CC is a potent angiogenic factor^[1].

The ED₅₀ is <1 ng/mL as measured by 3T3 cells.

Human

HEK293

Tag Free

Q9NRA1-1 (V235-G345)

56034  [NCBI]

VVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG

15-19 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized after extensive dialysis against PBS.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Zheng L, et al. PDGF-CC underlies resistance to VEGF-A inhibition and combinatorial targeting of both suppresses pathological angiogenesis more efficiently. Oncotarget. 2016 Nov 22;7(47):77902-77915.  [Content Brief]