1. Recombinant Proteins
  2. Others
  3. PDZD11 Protein, Human (His)

PDZD11 protein is a key mediator that promotes the docking of ADAM10 to adhesion zonules by interacting with PLEKHA7. PDZD11 is critical for subsequent binding to TSPAN33, which orchestrates complex protein-protein interactions at cellular junctions. PDZD11 Protein, Human (His) is the recombinant human-derived PDZD11 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PDZD11 protein is a key mediator that promotes the docking of ADAM10 to adhesion zonules by interacting with PLEKHA7. PDZD11 is critical for subsequent binding to TSPAN33, which orchestrates complex protein-protein interactions at cellular junctions. PDZD11 Protein, Human (His) is the recombinant human-derived PDZD11 protein, expressed by E. coli , with N-His labeled tag.

Background

PDZD11 Protein serves as a pivotal mediator in cellular interactions, facilitating the docking of ADAM10 to the zonula adherens through its interaction with PLEKHA7. This interaction is essential for the subsequent binding of PLEKHA7 to the ADAM10-binding protein TSPAN33, highlighting PDZD11's role in coordinating intricate protein-protein interactions at cellular junctions. Moreover, PDZD11 exhibits interactions with ATP2B1, ATP2B2, ATP2B3, ATP2B4, and ATP7A, implicating its involvement in calcium and copper transport processes. Its interaction with PLEKHA7 at the zonula adherens underscores its significance in the regulation of cell adhesion and signaling. Additionally, PDZD11 interacts with SLC5A6, indicating potential involvement in the modulation of sodium-dependent transport processes. The complex network of interactions suggests that PDZD11 plays a crucial role in orchestrating diverse cellular functions, warranting further investigation to unravel the precise molecular mechanisms and broader implications of PDZD11 in cellular signaling and junctional dynamics.

Species

Human

Source

E. coli

Tag

N-His

Accession

Q5EBL8-1 (D2-H140)

Gene ID
Molecular Construction
N-term
His
PDZD11 (D2-H140)
Accession # Q5EBL8-1
C-term
Synonyms
PDZ domain-containing protein 11; PMCA-interacting single-PDZ protein; AIPP1; PDZK11; PISP
AA Sequence

DSRIPYDDYPVVFLPAYENPPAWIPPHERVHHPDYNNELTQFLPRTITLKKPPGAQLGFNIRGGKASQLGIFISKVIPDSDAHRAGLQEGDQVLAVNDVDFQDIEHSKAVEILKTAREISMRVRFFPYNYHRQKERTVH

Molecular Weight

Approximately 18 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PDZD11 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PDZD11 Protein, Human (His)
Cat. No.:
HY-P77130
Quantity:
MCE Japan Authorized Agent: