PIG3 Protein, Human (His)

PIG3 is a key player in cellular processes, functioning as an enzyme that catalyzes NADPH-dependent quinone reduction. It exhibits moderate enzymatic activity towards β-naphthoquinone, with the para -quinone isomer (1,2-β-naphthoquinone) compared to the para -isomer (1,4-β-naphthoquinone). Obvious preference. PIG3 Protein, Human (His) is the recombinant human-derived PIG3 protein, expressed by E. coli , with N-6*His labeled tag. The total length of PIG3 Protein, Human (His) is 332 a.a., with molecular weight of ~37.5 kDa.

PIG3, or p53-induced gene 3, is a protein that catalyzes the NADPH-dependent reduction of quinones, showcasing a preference for the ortho-quinone isomer (1,2-beta-naphthoquinone) over the para isomer (1,4-beta-naphthoquinone). Additionally, PIG3 exhibits low enzymatic activity with beta-naphthoquinones and displays reductase activity for non-quinone compounds such as diamine and 2,6-dichloroindophenol in vitro. Beyond its enzymatic functions, PIG3 is involved in the generation of reactive oxygen species (ROS). This multifaceted role suggests that PIG3 may contribute to redox homeostasis by participating in quinone reduction and other reductase activities, while also being implicated in ROS production, highlighting its potential impact on cellular oxidative stress responses.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

N-6*His

Q53FA7 (M1-Q332)

9540  [NCBI]

MLAVHFDKPGGPENLYVKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNILGLEASGHVAELGPGCQGHWKIGDTAMALLPGGGQAQYVTVPEGLLMPIPEGLTLTQAAAIPEAWLTAFQLLHLVGNVQAGDYVLIHAGLSGVGTAAIQLTRMAGAIPLVTAGSQKKLQMAEKLGAAAGFNYKKEDFSEATLKFTKGAGVNLILDCIGGSYWEKNVNCLALDGRWVLYGLMGGGDINGPLFSKLLFKRGSLITSLLRSRDNKYKQMLVNAFTEQILPHFSTEGPQRLLPVLDRIYPVTEIQEAHKYMEANKNIGKIVLELPQ

Approximately 37.5 kDa

• 
  Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of sterile 50mM Tris-HCL, 300mM NaCl, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.