1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. PIG3 Protein, Human (His)

PIG3 Protein, Human (His)

Cat. No.: HY-P74632
SDS COA Handling Instructions

PIG3 is a key player in cellular processes, functioning as an enzyme that catalyzes NADPH-dependent quinone reduction. It exhibits moderate enzymatic activity towards β-naphthoquinone, with the para -quinone isomer (1,2-β-naphthoquinone) compared to the para -isomer (1,4-β-naphthoquinone). Obvious preference. PIG3 Protein, Human (His) is the recombinant human-derived PIG3 protein, expressed by E. coli , with N-6*His labeled tag. The total length of PIG3 Protein, Human (His) is 332 a.a., with molecular weight of ~37.5 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PIG3 is a key player in cellular processes, functioning as an enzyme that catalyzes NADPH-dependent quinone reduction. It exhibits moderate enzymatic activity towards β-naphthoquinone, with the para -quinone isomer (1,2-β-naphthoquinone) compared to the para -isomer (1,4-β-naphthoquinone). Obvious preference. PIG3 Protein, Human (His) is the recombinant human-derived PIG3 protein, expressed by E. coli , with N-6*His labeled tag. The total length of PIG3 Protein, Human (His) is 332 a.a., with molecular weight of ~37.5 kDa.

Background

PIG3, or p53-induced gene 3, is a protein that catalyzes the NADPH-dependent reduction of quinones, showcasing a preference for the ortho-quinone isomer (1,2-beta-naphthoquinone) over the para isomer (1,4-beta-naphthoquinone). Additionally, PIG3 exhibits low enzymatic activity with beta-naphthoquinones and displays reductase activity for non-quinone compounds such as diamine and 2,6-dichloroindophenol in vitro. Beyond its enzymatic functions, PIG3 is involved in the generation of reactive oxygen species (ROS). This multifaceted role suggests that PIG3 may contribute to redox homeostasis by participating in quinone reduction and other reductase activities, while also being implicated in ROS production, highlighting its potential impact on cellular oxidative stress responses.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q53FA7 (M1-Q332)

Gene ID
Molecular Construction
N-term
6*His
PIG3 (M1-Q332)
Accession # Q53FA7
C-term
Synonyms
Quinone oxidoreductase PIG3; TP53I3; PIG3
AA Sequence

MLAVHFDKPGGPENLYVKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNILGLEASGHVAELGPGCQGHWKIGDTAMALLPGGGQAQYVTVPEGLLMPIPEGLTLTQAAAIPEAWLTAFQLLHLVGNVQAGDYVLIHAGLSGVGTAAIQLTRMAGAIPLVTAGSQKKLQMAEKLGAAAGFNYKKEDFSEATLKFTKGAGVNLILDCIGGSYWEKNVNCLALDGRWVLYGLMGGGDINGPLFSKLLFKRGSLITSLLRSRDNKYKQMLVNAFTEQILPHFSTEGPQRLLPVLDRIYPVTEIQEAHKYMEANKNIGKIVLELPQ

Molecular Weight

Approximately 37.5 kDa

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of sterile 50mM Tris-HCL, 300mM NaCl, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PIG3 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PIG3 Protein, Human (His)
Cat. No.:
HY-P74632
Quantity:
MCE Japan Authorized Agent: