PILR-alpha Protein, Mouse (HEK293, Fc)

PILR-alpha Protein, a key member of paired immune system regulators, acts as a receptor for CD99 and PIANP. Its interactions with CD99 highlight its role in cellular recognition and immune response modulation. Paired receptors, featuring activating and inhibitory forms, finely tune immune system regulation. PILR-alpha's observed ligand interactions underscore its importance in mediating immune responses and cellular recognition processes. PILR-alpha Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PILR-alpha protein, expressed by HEK293 , with C-hFc labeled tag.

PILR-alpha Protein, a member of paired receptors pivotal in immune system regulation, serves as a receptor for CD99 and PIANP. Its involvement in interactions with CD99 underscores its role in cellular recognition and immune response modulation. Paired receptors, characterized by closely related activating and inhibitory forms, play a crucial role in finely tuning the regulatory mechanisms of the immune system. The observed interactions with specific ligands emphasize PILR-alpha's significance in mediating immune responses and cellular recognition processes.

Measured by its binding ability in a functional ELISA. Immobilized Mouse CD99 at 4 μg/mL (100 μL/well) can bind biotinylated PILR-alpha. The ED₅₀ for this effect is 0.3439 μg/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Mouse CD99 at 4 μg/mL (100 μL/well) can bind biotinylated PILR-alpha. The ED₅₀ for this effect is 0.3439 μg/mL.

Mouse

HEK293

C-hFc

Q2YFS3 (E32-V197)

231805  [NCBI]

ERSNRKNGFGVNQPESCSGVQGGSIDIPFSFYFPWKLAKDPQMSIAWRWKDFHGEFIYNSSLPFIHEHFKGRLILNWTQGQTSGVLRILNLKESDQTRYFGRVFLQTTEGIQFWQSIPGTQLNVTNATCTPTTLPSTTAATSAHTQNDITEVKSANIGGLDLQTTV

Approximately 60-80 kDa due to the glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4 or PBS, pH 6.5, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.