PILR-beta Protein, Human (HEK293, His)

PILR-β is part of a family of paired receptors that play a critical regulatory role in the immune system. PILR-β functions as an activating receptor and is thought to participate in cell signaling by binding to ITAM-bearing adapter molecules, suggesting its role in transmitting immune response signals. PILR-beta Protein, Human (HEK293, His) is the recombinant human-derived PILR-beta protein, expressed by HEK293 , with N-His labeled tag.

PILR-beta, a member of the paired receptors family, plays a crucial role in immune system regulation. As an activating receptor, PILRB is believed to engage in cellular signaling by associating with ITAM-bearing adapter molecules on the cell surface. This interaction suggests its involvement in transmitting signals that contribute to immune responses and modulation. The duality of activating and inhibitory receptors within the paired receptors family underscores their significance in finely tuning immune system activities.

Measured by its binding ability in a functional ELISA. Immobilized CL-P1 at 2μg/mL (100μL/well) can bind Biotinylated Human PILR-beta. The ED₅₀ for this effect is 1.808 μg/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized CL-P1 at 2μg/mL (100μL/well) can bind Biotinylated Human PILR-beta. The ED₅₀ for this effect is 1.808 μg/mL.

Human

HEK293

N-6*His

Q9UKJ0-1 (Q20-A189)

29990  [NCBI]

QPGGSTGSGPSYLYGVTQPKHLSASMGGSVEIPFSFYYPWELAIVPNVRISWRRGHFHGQSFYSTRPPSIHKDYVNRLFLNWTEGQESGFLRISNLRKEDQSVYFCRVELDTRRSGRQQLQSIKGTKLTITQAVTTTTTWRPSSTTTIAGLRVTESKGHSESWHLSLDTA

Approximately 30-33 kDa due to the glycosylation

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.