PLA2G16 Protein, Human (His)

The PLA2G16 protein has dual functions, acting as a phospholipase to exert calcium-independent PLA1 and PLA2 activities, preferentially releasing fatty acids through PLA1. It also acts as an O-acyltransferase and N-acyltransferase, helping to form N-acylphosphatidylethanolamine (the precursor of N-acylethanolamine). PLA2G16 Protein, Human (His) is the recombinant human-derived PLA2G16 protein, expressed by E. coli , with N-6*His labeled tag. The total length of PLA2G16 Protein, Human (His) is 121 a.a., with molecular weight of 14-17 kDa.

PLA2G16 protein exhibits a dual functionality, encompassing both phospholipase A1/2 and acyltransferase activities. As a phospholipase, it displays both calcium-independent PLA1 and PLA2 activities, efficiently releasing fatty acids from the sn-1 or sn-2 position of glycerophospholipids, with a notable prevalence of PLA1 activity. Additionally, PLA2G16 acts as an O-acyltransferase, facilitating the transfer of a fatty acyl group from glycerophospholipid to the hydroxyl group of lysophospholipid, and as an N-acyltransferase, catalyzing the calcium-independent transfer of a fatty acyl group from phosphatidylcholine and other glycerophospholipids to the primary amine of phosphatidylethanolamine. This process forms N-acylphosphatidylethanolamine, a precursor for N-acylethanolamines. Beyond its lipid-modifying enzymatic activities, PLA2G16 plays a crucial role in organelle rupture and degradation during eye lens terminal differentiation, contributing to lens transparency. Moreover, in the context of microbial infection, it acts as a host factor for picornaviruses, facilitating viral genome release into the cytoplasm during early infection and serving as a cellular sensor of membrane damage at virus entry sites. This multifaceted functionality underscores the diverse roles of PLA2G16 in cellular and infection-related processes.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

N-6*His

P53816 (D12-D132)

11145  [NCBI]

DLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRD

14-17 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 50 mM NaCl, 1 mM EDTA, pH 8.0.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.