1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Placental Lactogen/CSH1 Protein, Human (HEK293, His)

Placental Lactogen/CSH1 Protein, Human (HEK293, His)

Cat. No.: HY-P7871
Handling Instructions Technical Support

Placental Lactogen/CSH1 Protein, exclusive to pregnancy, orchestrates lactation, fetal growth, and metabolism. Its unique mode of action involves zinc-induced dimerization of the Prolactin Receptor (PRLR), distinct from the Growth Hormone Receptor (GHR). This specificity and structural versatility underline its pivotal role in intricate pregnancy-related processes and maternal physiology. Placental Lactogen/CSH1 Protein, Human (HEK293, His) is the recombinant human-derived Placental Lactogen/CSH1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Placental Lactogen/CSH1 Protein, Human (HEK293, His) is 191 a.a., with molecular weight of ~22-24 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Placental Lactogen/CSH1 Protein, exclusive to pregnancy, orchestrates lactation, fetal growth, and metabolism. Its unique mode of action involves zinc-induced dimerization of the Prolactin Receptor (PRLR), distinct from the Growth Hormone Receptor (GHR). This specificity and structural versatility underline its pivotal role in intricate pregnancy-related processes and maternal physiology. Placental Lactogen/CSH1 Protein, Human (HEK293, His) is the recombinant human-derived Placental Lactogen/CSH1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Placental Lactogen/CSH1 Protein, Human (HEK293, His) is 191 a.a., with molecular weight of ~22-24 kDa.

Background

Placental Lactogen/CSH1 Protein, exclusively generated during pregnancy, plays a pivotal role in orchestrating lactation, fetal growth, and metabolic processes. Remarkably, it exhibits a unique mode of action, as it does not interact with the Growth Hormone Receptor (GHR). Instead, its activation is exclusively mediated through zinc-induced dimerization of the Prolactin Receptor (PRLR). This distinctive mechanism contributes to the protein's specificity and underscores its significance in the intricate processes associated with pregnancy and maternal physiology. Notably, Placental Lactogen/CSH1 can exist in both monomeric and dimeric forms, highlighting its structural versatility.

Biological Activity

Measured in a cell proliferation assay using Nb211 rat lymphoma cells. The ED50 for this effect is 0.2359 ng/mL, corresponding to a specific activity of 4.240 x 106 units/mg.

  • Measured in a cell proliferation assay using Nb211 rat lymphoma cells. The ED50 for this effect is 0.2359 ng/mL, corresponding to a specific activity of 4.240 x 106 units/mg.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

P0DML2 (V27-F217)

Gene ID
Molecular Construction
N-term
CSH1 (V27-F217)
Accession # P0DML2
6*His
C-term
Synonyms
rHuPlacental Lactogen/CSH1, His; Chorionic Somatomammotropin Hormone; Choriomammotropin; Lactogen; Placental Lactogen; PL; CSH1
AA Sequence

VQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF

Molecular Weight

Approximately 22-24kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Placental Lactogen/CSH1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Placental Lactogen/CSH1 Protein, Human (HEK293, His)
Cat. No.:
HY-P7871
Quantity:
MCE Japan Authorized Agent: