2. Recombinant Proteins
  3. Others
  4. Plexin B1 Protein, Human (HEK293, mFc)

Plexin B1 Protein, Human (HEK293, mFc)

Cat. No.: HY-P700428
Handling Instructions

Plexin B1 Protein, a receptor for SEMA4D, crucially influences GABAergic and inhibitory synapse development. It activates RHOA, leading to actin cytoskeleton changes, impacting axon guidance, invasive growth, and cell migration. As a monomer or heterodimer with PLXNB2, Plexin B1 binds activated RAC1 and interacts with various proteins. Its interaction with SEMA4D emphasizes its intricate involvement in cellular signaling pathways and synaptic development. Plexin B1 Protein, Human (HEK293, mFc) is the recombinant human-derived Plexin B1 protein, expressed by HEK293, with N-mFc labeled tag. The total length of Plexin B1 Protein, Human (HEK293, mFc) is 516 a.a., with molecular weight of 83.2 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Plexin B1 Protein, a receptor for SEMA4D, crucially influences GABAergic and inhibitory synapse development. It activates RHOA, leading to actin cytoskeleton changes, impacting axon guidance, invasive growth, and cell migration. As a monomer or heterodimer with PLXNB2, Plexin B1 binds activated RAC1 and interacts with various proteins. Its interaction with SEMA4D emphasizes its intricate involvement in cellular signaling pathways and synaptic development. Plexin B1 Protein, Human (HEK293, mFc) is the recombinant human-derived Plexin B1 protein, expressed by HEK293, with N-mFc labeled tag. The total length of Plexin B1 Protein, Human (HEK293, mFc) is 516 a.a., with molecular weight of 83.2 kDa.
Background

The Plexin B1 Protein acts as a receptor for SEMA4D, playing a critical role in GABAergic synapse development and mediating SEMA4A- and SEMA4D-dependent inhibitory synapse development. Additionally, it is involved in RHOA activation and subsequent changes in the actin cytoskeleton, contributing to axon guidance, invasive growth, and cell migration. It exists as a monomer and forms heterodimers with PLXNB2 after proteolytic processing. Plexin B1 binds to activated RAC1 and interacts with various proteins, including PLXNA1, ARHGEF11, ARHGEF12, ERBB2, MET, MST1R, RRAS, RHOD, RND1, NRP1, and NRP2. The interaction with SEMA4D promotes the binding of cytoplasmic ligands, emphasizing its intricate involvement in cellular signaling pathways and synaptic development.
Species

Human
Source

HEK293
Tag

N-mFc
Accession

O43157 (L20-Q535)
Gene ID
Molecular Construction
N-term
mFc
Plexin B1 (L20-Q535)
Accession # O43157
C-term
Synonyms
Plexin-B1; PLXNB1; Semaphorin receptor SEP; KIAA0407; PLXN5; SEP
AA Sequence

LQPLPPTAFTPNGTYLQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQYVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSRGVGGGIPPITTRALWPPDPQAAFSYEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQSRAFRAYVSRVCLRDQHYYSYVELPLACEGGRYGLIQAAAVATSREVAHGEVLFAAFSSAAPPTVGRPPSAAAGASGASALCAFPLDEVDRLANRTRDACYTREGRAEDGTEVAYIEYDVNSDCAQLPVDTLDAYPCGSDHTPSPMASRVPLEATPILEWPGIQLTAVAVTMEDGHTIAFLGDSQGQLHRVYLGPGSDGHPYSTQSIQQGSAVSRDLTFDGTFEHLYVMTQSTLLKVPVASCAQHLDCASCLAHRDPYCGWCVLLGRCSRRSECSRGQGPEQWLWSFQPELGCLQ

Molecular Weight

83.2 kDa
Purity

Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

Plexin B1 Protein, Human (HEK293, mFc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Plexin B1 Protein, Human (HEK293, mFc)
Cat. No.:
HY-P700428
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

SAFETY DATA SHEET (SDS)

English - EN (0 KB) Français - FR (0 KB) Deutsch - DE (0 KB) Norwegian - NO (0 KB) Español - ES (0 KB) Swedish - SV (0 KB)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.