1. Recombinant Proteins
  2. Others
  3. PMP2 Protein, Human (His)

The PMP2 protein may act as a lipid transporter within Schwann cells, suggesting a role in lipid transport and cellular homeostasis. PMP2 may also bind cholesterol, suggesting involvement in cholesterol-related pathways. PMP2 Protein, Human (His) is the recombinant human-derived PMP2 protein, expressed by E. coli , with N-6*His labeled tag. The total length of PMP2 Protein, Human (His) is 132 a.a., with molecular weight of 14-20 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PMP2 protein may act as a lipid transporter within Schwann cells, suggesting a role in lipid transport and cellular homeostasis. PMP2 may also bind cholesterol, suggesting involvement in cholesterol-related pathways. PMP2 Protein, Human (His) is the recombinant human-derived PMP2 protein, expressed by E. coli , with N-6*His labeled tag. The total length of PMP2 Protein, Human (His) is 132 a.a., with molecular weight of 14-20 kDa.

Background

The PMP2 protein is implicated in potentially serving as a lipid transport protein within Schwann cells, suggesting its involvement in the intricate processes of lipid transport and cellular homeostasis. Additionally, PMP2 may play a role in binding cholesterol, indicating its potential participation in cholesterol-related pathways or cellular functions. Structurally, PMP2 functions as a monomer, underscoring its individual unit within the cellular machinery. The precise mechanisms by which PMP2 contributes to lipid transport and cholesterol binding, as well as its specific role in Schwann cell biology, remain areas of interest, warranting further exploration to unravel its functional significance and molecular interactions in the context of lipid homeostasis.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P02689 (M1-V132)

Gene ID
Molecular Construction
N-term
6*His
PMP2 (M1-V132)
Accession # P02689
C-term
Synonyms
Myelin P2 Protein; Peripheral Myelin Protein 2; PMP2
AA Sequence

MSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV

Molecular Weight

14-20 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Citrate, 10% Trehalose, 100 mM NaCl, 0.05% Tween 80, pH 4.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PMP2 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PMP2 Protein, Human (His)
Cat. No.:
HY-P71066
Quantity:
MCE Japan Authorized Agent: