1. Recombinant Proteins
  2. Others
  3. Podoplanin Protein, Mouse (HEK293, Fc)

Podoplanin plays a crucial role in cell migration and adhesion by interacting with various partners. It promotes platelet activation and aggregation by binding to CLEC1B, but attenuates platelet aggregation and lung metastasis by interacting with CD9. Podoplanin Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Podoplanin protein, expressed by HEK293 , with C-hFc labeled tag. The total length of Podoplanin Protein, Mouse (HEK293, Fc) is 111 a.a., with molecular weight of 55-70 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Podoplanin plays a crucial role in cell migration and adhesion by interacting with various partners. It promotes platelet activation and aggregation by binding to CLEC1B, but attenuates platelet aggregation and lung metastasis by interacting with CD9. Podoplanin Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Podoplanin protein, expressed by HEK293 , with C-hFc labeled tag. The total length of Podoplanin Protein, Mouse (HEK293, Fc) is 111 a.a., with molecular weight of 55-70 kDa.

Background

Podoplanin protein mediates diverse effects on cell migration and adhesion through its interactions with various partners. During development, it plays a crucial role in the separation of blood and lymphatic vessels by binding to CLEC1B, triggering CLEC1B activation in platelets and leading to platelet activation and/or aggregation. Conversely, interaction with CD9 attenuates platelet aggregation and pulmonary metastasis induced by Podoplanin. In cell migration and adhesion, Podoplanin exhibits multifaceted functions through interactions with MSN or EZR, promoting epithelial-mesenchymal transition, ERZ phosphorylation, and triggering RHOA activation, ultimately increasing cell migration and invasiveness. Binding with CD44 promotes directional cell migration in epithelial and tumor cells. In lymph nodes, Podoplanin controls fibroblastic reticular cells (FRCs) adhesion to the extracellular matrix and contraction of the actomyosin. Engagement of CLEC1B by Podoplanin in FRCs promotes relaxation by blocking lateral membrane interactions, leading to the reduction of ERM proteins and MYL9 activation. Additionally, Podoplanin interacts with LGALS8, possibly participating in connecting the lymphatic endothelium to the surrounding extracellular matrix. In keratinocytes, Podoplanin induces changes in cell morphology, including elongated shape, membrane protrusions, actin cytoskeleton reorganization, increased motility, and decreased cell adhesion. It also plays a role in controlling invadopodia stability and maturation in tumor cells, contributing to efficient degradation of the extracellular matrix. Podoplanin is required for normal lung cell proliferation and alveolus formation at birth, but it does not function as a water channel or a regulator of aquaporin-type water channels and has no effect on folic acid or amino acid transport. It forms homodimers and interacts with various proteins, including CLEC1B, CD9, LGALS8, HSPA9, CD44, MSN, EZR, and CCL21, each interaction contributing to different aspects of Podoplanin's multifaceted functions.

Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

Q62011 (G23-K133)

Gene ID
Molecular Construction
N-term
Podoplanin (G23-K133)
Accession # Q62011
hFc
C-term
Synonyms
Podoplanin; Aggrus; Glycoprotein 38; Gp38; PA2.26 antigen; T1-alpha; T1A
AA Sequence

GTIGVNEDDIVTPGTGDGMVPPGIEDKITTTGATGGLNESTGKAPLVPTQRERGTKPPLEELSTSATSDHDHREHESTTTVKVVTSHSVDKKTSHPNRDNAGDETQTTDKK

Molecular Weight

55-70 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

Podoplanin Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Podoplanin Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P71219
Quantity:
MCE Japan Authorized Agent: