PP1MG Protein, Human (His)

PP1MG Protein, a member of PPM family of serine/threonine phosphatases, has an important role in controlling cell cycle progression. PP1MG Proteinregulates the phosphorylation of SRSF3 in hepatocellular carcinoma (HCC) and contributes to the proliferation, invasion, and metastasis of HCC. PP1MG Protein forms a distinct holoenzyme complex with the PP2A regulatory subunit B56δ. B56δ‐PPM1G dephosphorylates α‐catenin at serine 641, which is necessary for the appropriate assembly of adherens junctions and the prevention of aberrant cell migration^[1][2]. PP1MG Protein, Human (His) is the recombinant human-derived PP1MG protein, expressed by E. coli , with C-6*His labeled tag. The total length of PP1MG Protein, Human (His) is 230 a.a., with molecular weight of ~30.0 kDa.

PPM phosphatase family consists of at least 17 members. PPM phosphatases are dependent on Mg2+ or Mn2+ ions for their activity. PP1MG Protein, Human (His) forms a distinct holoenzyme complex with the PP2A regulatory subunit B56δ. B56δ promotes the re‐localization of PPM1G to the cytoplasm where the phosphatase can access a discrete set of substrates.α‐catenin, a component of adherens junction, as a new substrate for the PPM1G‐B56 phosphatase complex in the cytoplasm. B56δ‐PPM1G dephosphorylates α‐catenin at serine 641^[1].
Overexpression of PPM1G promotes the dephosphorylation of SRSF3 and changes the alternative splicing patterns of genes related to the cell cycle, the transcriptional regulation in HCC cells. The knockdown of PPM1G inhibited tumor growth in vivo^[2].

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

C-6*His

O15355 (M317-D546)

5496  [NCBI]

MEGKEEPGSDSGTTAVVALIRGKQLIVANAGDSRCVVSEAGKALDMSYDHKPEDEVELARIKNAGGKVTMDGRVNGGLNLSRAIGDHFYKRNKNLPPEEQMISALPDIKVLTLTDDHEFMVIACDGIWNVMSSQEVVDFIQSKISQRDENGELRLLSSIVEELLDQCLAPDTSGDGTGCDNMTCIIICFKPRNTAELQPESGKRKLEEVLSTEGAEENGNSDKKKKAKRD

Approximately 30.0 kDa

Greater than 83% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 25 mM Tris-HCl, 1 mM DTT, 1 mM EDTA, 2 mM β-ME, 20% Glycerol, pH 7.5.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.