PPAR-gamma Protein, Human (P37231-2, His)

The PPAR gamma protein is a nuclear receptor that binds to peroxisome proliferators and is activated upon ligand binding to specific PPREs on DNA. It regulates target gene transcription and controls fatty acid metabolism. PPAR-gamma Protein, Human (P37231-2, His) is the recombinant human-derived PPAR-gamma protein, expressed by E. coli , with C-6*His labeled tag.

PPAR gamma Protein, a nuclear receptor, binds to peroxisome proliferators such as hypolipidemic drugs and fatty acids. Upon ligand activation, the nuclear receptor interacts with specific PPAR response elements (PPRE) on DNA, modulating the transcription of target genes like acyl-CoA oxidase and thereby controlling the peroxisomal beta-oxidation pathway of fatty acids. It plays a pivotal role as a key regulator in adipocyte differentiation and glucose homeostasis. Additionally, PPAR gamma acts as a critical regulator of gut homeostasis by suppressing NF-kappa-B-mediated pro-inflammatory responses. In the context of cardiovascular circadian rhythms, it regulates the transcription of BMAL1 in blood vessels. Furthermore, in response to microbial infection, particularly treatment with M.tuberculosis or its lipoprotein LpqH, PPAR gamma modulates phosphorylation of MAPK p38 and IL-6 production, suggesting its involvement in immune responses during microbial challenges.

Human

E. coli

C-6*His

P37231-2 (E207-Y477)

5468  [NCBI]

ESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY

Approximately 31 kDa

Greater than 90% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.